KEGG   Serratia plymuthica 4Rx13: SOD_c00450Help
Entry
SOD_c00450        CDS       T02710                                 

Gene name
fdoH
Definition
(GenBank) formate dehydrogenase-O iron-sulfur subunit FdoH
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00630  Glyoxylate and dicarboxylate metabolism
srl00680  Methane metabolism
srl01100  Metabolic pathways
srl01120  Microbial metabolism in diverse environments
srl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SOD_c00450 (fdoH)
  09102 Energy metabolism
   00680 Methane metabolism
    SOD_c00450 (fdoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_6 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_17 Fer4_16 Fer4_22 Fer4_8 Fer4_13 Fer4_20 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AGO53081
UniProt: S0A7Z4
Position
50928..51827
Genome map
AA seq 299 aa AA seqDB search
MAMQSQDIIRKSATNGFTPAPRARDHQEEVAKLIDVTTCIGCKACQVACSEWNDIRDEIG
SNVGVYDNPADLTAKSWTVMRFSEVEENGKLEWLIRKDGCMHCADPGCLKACPSEGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFDVPRMNKDDNRVYKCTLCVDRVDVGQEPACVKTCP
TGAIHFGTKDAMKQIAAERVGELNTRGYQNAGLYDPAGVGGTHVMYVLHHADKPQLYHGL
PNNPTISPAITFWKGVWKPLAAIGFAATFAASVFHYVGVGPNRVEEEDNDELHDEETRK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcaatctcaggacatcattcgtaaatccgccaccaatggtttcacgccggcc
ccgcgcgcccgtgaccatcaggaagaagtggccaaacttatcgatgtcaccacctgtatc
ggctgcaaggcctgtcaggtggcctgttccgaatggaacgacattcgcgatgaaatcggc
agcaacgtcggggtgtacgataaccccgccgatctgaccgccaagtcgtggacggtcatg
cgcttctccgaagtggaggaaaacggcaagctggaatggttgatccgcaaggacggctgc
atgcactgcgccgatccgggttgcctgaaggcttgcccgtcggaaggcgcaatcattcag
tacgccaacggcatcgtcgacttccagtccgagcactgcatcggctgcggctactgcatc
gccggctgcccgttcgacgtgccgcgcatgaacaaggacgacaaccgggtgtacaaatgc
accctgtgcgtcgaccgcgtcgatgtcggccaggaaccggcctgcgtgaagacctgcccg
accggcgcgattcatttcggcaccaaggacgcgatgaagcagattgccgccgagcgcgtc
ggcgagctgaacacccgcggttatcagaacgccggtctgtacgatccggcgggcgtgggc
ggcacccacgtgatgtatgtgctgcaccacgccgacaaaccgcagctgtatcacggtttg
ccgaataacccgaccatcagcccggcgatcacgttctggaaaggcgtgtggaaacccctg
gcggccatcggctttgccgccacctttgcagccagcgtgttccactatgtcggcgtcggg
ccaaaccgcgtcgaagaggaagacaacgacgagctgcacgatgaggagacgcgcaaatga

DBGET integrated database retrieval system