KEGG   Serratia plymuthica 4Rx13: SOD_c00460Help
Entry
SOD_c00460        CDS       T02710                                 

Gene name
fdoI
Definition
(GenBank) formate dehydrogenase, cytochrome b556(fdo) subunit
  KO
K00127  formate dehydrogenase subunit gamma
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00630  Glyoxylate and dicarboxylate metabolism
srl00680  Methane metabolism
srl01100  Metabolic pathways
srl01120  Microbial metabolism in diverse environments
srl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SOD_c00460 (fdoI)
  09102 Energy metabolism
   00680 Methane metabolism
    SOD_c00460 (fdoI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB DUF4405 PepSY_TM DBD_Tnp_Hermes
Motif
Other DBs
NCBI-ProteinID: AGO53082
UniProt: S0A9I4
Position
51824..52459
Genome map
AA seq 211 aa AA seqDB search
MKKEKRIQRYSAPERINHWIVAFCFVFAAISGLGFFFPSFNWLMNILGTPQLARILHPFV
GAFMFAAFLLMFLRYWKHNLINREDIVWAKNIHKIAMNEEVGDTGRYNFGQKCVFWAAIV
SLVLLLASGVVIWRPYFAPSFPIPLIRIALLVHSLAAVGLIIVIMVHIYAALWVKGTITA
MVEGWVPAAWAKKHHPRWYREVREKQQEDKP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaaaagcggattcagcgctacagcgcgccggagcggattaaccactggatt
gtggcgttctgtttcgtgttcgcggccatcagcgggctggggttctttttcccctccttc
aactggctgatgaacatcttaggtacgccgcagttggcgcgcatcctgcacccctttgtc
ggcgctttcatgtttgcggccttcctgctgatgttcctgcgctactggaagcataatctg
atcaaccgcgaagacatcgtctgggccaaaaacatccacaaaatcgccatgaacgaggaa
gtgggcgataccgggcgttataatttcggtcagaagtgcgtattctgggcagctatcgtc
agcctggtgctgctgttggccagcggtgtggtgatctggcggccgtactttgcgccgtcg
ttcccgataccgctgatccgcatcgcgctgctggtgcattcgctggcggcggtcggcctg
atcatcgtgataatggtgcacatttacgccgcgctgtgggtaaaaggcactatcaccgcg
atggtcgaaggctgggtgcctgcggcctgggctaaaaaacatcatccgcgctggtaccga
gaggtccgcgagaaacaacaggaagacaaaccctga

DBGET integrated database retrieval system