KEGG   Serratia plymuthica 4Rx13: SOD_c00470Help
Entry
SOD_c00470        CDS       T02710                                 

Gene name
fdhE
Definition
(GenBank) protein FdhE
  KO
K02380  FdhE protein
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    SOD_c00470 (fdhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FdhE AAA_16 DZR Stc1 zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: AGO53083
UniProt: S0A7U1
Position
52459..53388
Genome map
AA seq 309 aa AA seqDB search
MSIRIVPKEQLGAQREKSTTAETIPPLLFANLKSLYSRRAERLRKLATDNPLGDYLNFAA
QLAEAQHHALHDNPLQLDLTEALQQGAASGKPPLDLSVYPRSEHWHRLLGSLIAELRPQA
PEHILAVLDNLEKASAHELELMADALLNREFGKIGSEKAPFIWAALSLYWAQMASLIPGK
ARAEYGEHRQFCPVCGSIPVSSVVHIGTVSGLRYLHCNLCESEWHVVRIKCSNCEQTRDL
NYWSLDSELAAVKAESCGDCGTYLKILYQEKDPHIEAVADDLASLVLDAKLEDEGFARSS
INPFLFPGE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccgcatcgttcctaaagagcagttaggggcacagcgcgagaagtccacaacg
gcggagacaattccgccgttacttttcgccaatttgaaaagcctctacagccgccgcgcc
gaacgcctgcgcaagctggcgacggacaacccgctgggcgactacctgaacttcgccgcc
caactggccgaggcgcagcaccatgcgctgcacgacaacccgctgcagttggatctgacc
gaagcgctgcagcagggcgcggccagcggcaagccgccgctggatttgagcgtctatccg
cgcagcgagcattggcaccggctgctgggctcgttgatcgccgagctgcgtccgcaggcg
ccggaacacattctggcggtgctggataacctggaaaaggcgtcagcgcatgagctggag
ctgatggccgacgccttgctcaaccgcgagttcggcaagatcggcagcgagaaagcgccg
ttcatctgggccgcgctgtcgctttactgggcgcaaatggcaagcctgatccccggcaag
gcgcgtgcggaatatggcgagcatcgccagttctgcccggtgtgcggcagcattccggtc
tccagcgtggtgcatatcggcaccgtcagcggcctgcgctatttgcactgcaacctgtgc
gaaagcgagtggcacgtggtgcggataaaatgcagcaactgcgagcaaacccgcgatctg
aattactggtcgctggacagcgagctggcggcggtgaaagcggaaagctgcggcgactgc
ggtacttacctgaagattttgtatcaggaaaaggacccgcatatcgaagctgtggccgac
gatctggcctcgctggtgctcgacgccaagctggaagacgaaggttttgcccgcagcagc
atcaacccgtttctgttcccgggggagtaa

DBGET integrated database retrieval system