KEGG   Serratia plymuthica 4Rx13: SOD_c00480Help
Entry
SOD_c00480        CDS       T02710                                 

Definition
(GenBank) hypothetical protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcrB
Motif
Other DBs
NCBI-ProteinID: AGO53084
UniProt: S0AAR2
Position
53520..54161
Genome map
AA seq 213 aa AA seqDB search
MLKTIAKLTAVAVLAIGLSACDNKEDTKPAVPKPDPKPIVTQPIAPPPPPVESEPVGLKV
SLQRGNVTFLLPAGFSDQTQNSGIVNDSKSTIQRFLDGKTRQSTVSSEVVPPDDMKLNTS
DKMLKDLTQSIITELADRYQNIKTTKEENFIVGKQKFHRLDTEQNVNGQKVLSTFVLTVL
NKRVVTLQMLSPAKTPEAHQALVQRIIDTLVVK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaccattgcgaaacttacggcggtcgccgttctggcgatcgggctgtcggcc
tgtgacaacaaggaagacaccaaaccggcagtacctaagccggaccccaagccgatcgtc
acgcagcccattgcgccgccaccgccaccggtggaaagcgagcctgtggggctgaaggta
tcgctgcaaaggggtaacgtgacctttttactgccggcggggttcagcgatcagacccag
aacagcggcatcgtcaacgacagcaaatccaccattcagcgtttcctcgacggcaagaca
cgccagagcaccgtctcttccgaagtggtcccgcctgacgacatgaagctcaacaccagc
gataaaatgctgaaagatttgacgcaaagcatcatcaccgagctggccgaccgctatcag
aatatcaagaccaccaaagaagagaacttcatcgtcggcaagcagaagttccatcggctg
gataccgagcaaaacgtcaatgggcaaaaggtactctccacttttgtgctgacggtattg
aataaaagggtggtgacgttgcaaatgctgtcaccggccaaaacgccggaggcgcaccag
gcgctggttcagcggattatcgacacgctggtggtgaaataa

DBGET integrated database retrieval system