KEGG   Serratia plymuthica 4Rx13: SOD_c00560Help
Entry
SOD_c00560        CDS       T02710                                 

Gene name
yahJ
Definition
(GenBank) YahJ
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_3 Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: AGO53092
UniProt: S0A9J3
Position
complement(62171..63655)
Genome map
AA seq 494 aa AA seqDB search
MANVAANLRVPLLNWWVFFDVPHLWIKELNVEKNQQQSRRAFLSQTGKLTTACAVIGLTG
GVAQAAPQAGGHCAPEAKPMTLTDHHYMLSDVRLEEGFEYDGDTVIGTRTALYQLEIKDG
NIAAIHAADAAPIAGVPRYQAQGQLLLPAFRDMHIHLDKTFYSGPWQAPRPRQGKTIMDM
IALEQTLIPKLLPTSQQRAENLIALLQSKGSTVARSHCNIDPVSGLKSLEHLQRALENHQ
ADFSCEIVAFPQHGLLHSKVDGLMREAMQMGVQYVGGLDPTNVDGAMEASLDAMFQIALD
TGKGVDIHLHETSPAGVAAINYMIATVEKNPALRGKVTISHAFALTTLNPNELAETATRL
AAQQITIASTVPIGGLMMPLPQLSEKGVFVMTGTDSVIDHWSPFGTGDILEKANLYAQLY
RGSDEFHLSRAMAISTGGVLPLNDKGQRAWPKAGDSAEFVLIDASCSAEAVARLPARRAT
FHRGRLVAGQVSKA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgtcgctgccaacctgcgggttcctctcctaaattggtgggtgttttttgac
gtacctcacctctggattaaggaactgaacgtggaaaaaaaccaacaacaaagccgcaga
gctttcctcagccaaaccggcaagctaaccaccgcctgcgcggtgatcgggctgaccggc
ggcgtggcgcaggctgcaccgcaagctggcggccactgtgcgccggaggccaaacccatg
accctgaccgaccatcactacatgctgagcgacgtacggctggaggagggtttcgaatac
gatggcgatacggtgattggcacccgcaccgcgctctaccagttggaaatcaaagacggc
aacattgccgccatccatgcggcggatgcggcacctatcgccggcgtgccgcgctatcag
gcgcagggtcagttgctgctgccggcgtttcgcgacatgcacatccatttggacaaaacc
ttctacagcggcccatggcaggcaccgcgcccacgccagggcaaaaccatcatggacatg
atcgcgctggaacaaacgctgatccccaaactgctgccgacttcgcagcagcgcgcggaa
aacctgatcgccctgttgcaatccaaaggcagcaccgtagcgcgcagccactgcaatatc
gatccggtcagcgggttgaaaagcctggagcacctgcaacgtgcgctggaaaaccatcag
gcggatttcagctgtgaaatcgtcgccttcccgcagcacggcctgttgcattctaaggtc
gacggcttgatgcgcgaggccatgcagatgggcgtgcaatacgtcggcgggctggatccg
accaacgtcgacggtgcgatggaggcgtcgctggacgcgatgttccagattgcactcgac
accggcaaaggcgtcgacatccacctgcatgaaaccagccccgccggggtagcggcgatt
aactacatgatcgccaccgtagaaaaaaacccggcgctgcgcggtaaggtcaccatcagc
cacgccttcgccctgactacgctgaacccgaatgagctggcggaaaccgccacccgcctg
gcagcgcagcaaatcaccatcgcctctacggtgccgatcggcgggctgatgatgccgctg
ccgcagctcagtgaaaaaggggtatttgtgatgaccggaaccgacagcgtgatcgatcat
tggtcgccgttcggtaccggcgacattctggaaaaagccaatctttacgcccaactttat
cgcggttcggatgagttccatctgtcgcgcgccatggccatttccaccggcggcgtgctc
ccgctgaacgacaaaggccaacgcgcgtggcccaaagccggcgacagcgcggaattcgtg
ttgatcgatgccagttgctccgccgaggcggtggcccgcctgcccgcacgccgcgccacc
ttccatcgggggcgtctggtcgccgggcaggtcagcaaagcctga

DBGET integrated database retrieval system