KEGG   Serratia plymuthica 4Rx13: SOD_c00600Help
Entry
SOD_c00600        CDS       T02710                                 

Gene name
xylG
Definition
(GenBank) xylose import ATP-binding protein XylG
  KO
K10545  D-xylose transport system ATP-binding protein [EC:3.6.3.17]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl02010  ABC transporters
Module
srl_M00215  D-Xylose transport system
Brite
KEGG Orthology (KO) [BR:srl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SOD_c00600 (xylG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srl02000]
    SOD_c00600 (xylG)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     SOD_c00600 (xylG)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter [MD:M00215] [OT]
    SOD_c00600 (xylG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_22 RsgA_GTPase AAA_23 AAA_15 MCM AFG1_ATPase AAA_30 AAA_33 G-alpha
Motif
Other DBs
NCBI-ProteinID: AGO53096
UniProt: S0A810
Position
67900..69441
Genome map
AA seq 513 aa AA seqDB search
MPCLLEMKNITMQFGAVKAVDNVSLQLEAGQVLSLCGENGSGKSTLMKVLCGIYPHGSYQ
GDIYFSDDVLAAKNIRDTEKKGIAIIHQELALVKQMTVLENMFLGNEQCRRGVMDYDAMY
LRCRRMLAQVKLEVDPNTRVGELGLGQQQLVEIAKALNKQVRLLVLDEPTASLTESETAT
LLAIIQDLRDHGIACIYISHKLNEVKAISDLICVIRDGKPIGTRPAAEMSEKDIIAMMVG
RELTELYPQQEHAIGDVILQVDNLTAWHPVNRHVRRVDEVSFSLRRGEILGVAGLVGSGR
TETMQCLFGVYAGRWQGSIRINGQPAVIDNCRQAMRHGIAMVPEDRKRDGIVPVMGVGAN
MTLAALSDFSGALTVIDDAQEQATIRQSLAQLKVKTSSPELAIARLSGGNQQKAILAKCL
LLKPKILILDEPTRGIDIGAKQEIYKLINQLVQQGIAVIVVSSELPEVLGLSDRVLVMHQ
GRIKASLENRGLTQEQVMEAALRSETDVEKHAV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgccctgcctattggaaatgaaaaatatcaccatgcaattcggcgcagtcaaggccgtg
gataatgtcagcctgcaactggaggccggccaggtattatcgttatgcggtgaaaacggg
tcgggaaaatccacgctgatgaaagtgctgtgcggaatatatccgcacggcagttatcag
ggcgatatttatttttccgacgatgtgttggcggcaaaaaatatccgcgacaccgagaaa
aaaggcattgccatcattcatcaggaattggcgttggtgaagcagatgacggtgctggaa
aacatgtttctcggcaacgaacagtgtcgccgtggcgtgatggattacgacgccatgtac
ctgcgctgccggcgcatgctggcgcaggtcaagctggaggtggatcccaatacccgcgtc
ggcgagttggggttggggcagcagcaactggtggagatcgccaaggcgctcaacaagcag
gtacggctgctggtgctggatgaaccgacggcgtcgttgaccgaaagcgaaactgccacg
ttgttggcgatcattcaggatctgcgcgatcacggcatcgcctgcatttacatttcgcac
aagctgaacgaggtgaaagcgatctcggatctgatctgcgtgatccgcgacggcaagcct
atcggcacgcggccggcggccgagatgagcgaaaaagacattatcgccatgatggtgggg
cgcgaactgaccgagctgtatccgcagcaggaacatgcgatcggcgacgtgattttgcag
gtggataacctgaccgcctggcatccggtgaaccgccacgtccgccgggtggatgaggtg
tcgttcagcctgcggcgcggcgaaattcttggcgtcgccgggttggtcggctccggccgt
accgagaccatgcagtgtttgttcggcgtctatgccggccgctggcagggcagcatccgc
attaacggtcagccggccgtgatcgacaattgccgacaggcgatgcgccacggcatcgcc
atggtgccggaagaccgcaagcgcgacggcattgtgccggtgatgggcgtcggggcgaat
atgacgctggcggcgctgagcgatttcagcggcgcattgacggtgatcgacgatgcgcag
gaacaggcgaccattcgccagtcgttggcgcaactgaaggtgaaaacgtcgtcgcccgag
ctggcgatcgccaggctgagcggcggcaaccagcagaaggcgattttggccaaatgcctg
ctgctgaagccgaaaatcctcattcttgatgagccgacacgcggtatcgatatcggtgca
aaacaggaaatctataaattaatcaatcagctggtacagcagggtatcgcggtgatcgtg
gtgtcttcggagctgccggaagtgctgggcctcagcgaccgcgtgttggtgatgcatcag
gggcgtatcaaggcgtcgctggagaaccggggtttgacccaggaacaggtgatggaagcc
gcattgaggagtgaaacagatgtcgaaaagcacgcagtctga

DBGET integrated database retrieval system