KEGG   Serratia plymuthica 4Rx13: SOD_c00620Help
Entry
SOD_c00620        CDS       T02710                                 

Gene name
xylR1
Definition
(GenBank) xylose operon regulatory protein XylR
  KO
K02529  LacI family transcriptional regulator
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srl03000]
    SOD_c00620 (xylR1)
Transcription factors [BR:srl03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    SOD_c00620 (xylR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 HTH_AraC HTH_18 Peripla_BP_4 H2O2_YaaD
Motif
Other DBs
NCBI-ProteinID: AGO53098
UniProt: S0A7V6
Position
70825..72003
Genome map
AA seq 392 aa AA seqDB search
MFAKRFRITLLFNANKVYDRQVVEGVGEYLQASQCDWDIFIEEDFRCRIDNIKDWLGDGV
IADYDDREIERLLHNVNVPIVGVGGSYHREEDYPPVHYIATDNQALVEAAFMHLKEKGVN
RFAFYGLPAEGGKRWAQEREQAFRQRVAAEQYQGVVYQGMATAPENWQYAQNRLADWVQT
LPQQTGIIAVTDARARHLLQVCEHLDIAVPEKLCVIGIDNEELTRYLSRVALSSVAQGTR
QMGYRAAKLLHQLLDRRELPLQRILVPPVKVIERRSTDFRSLRDPAVIQAMHYIRHHACK
GIKVEQVLDAVGMSRSNLEKRFRDETGATIHHMIHQEKLERARNLLTATSLTINEISQMC
GYPSLQYFYSVFKKGYDATPKEYRERHGETGY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgaagcgctttcgcattacgttactgttcaacgccaataaggtgtatgaccgc
caggtggtcgagggcgtcggcgagtatttacaggcttcacagtgtgactgggacatcttt
atcgaagaggattttcgttgccgtatcgacaacatcaaggactggctgggcgatggggtg
atcgccgattacgacgatcgcgagattgagcggttgctgcataacgtcaatgtgccgatc
gtcggcgttggcggctcctatcaccgtgaagaggattacccgccggtgcactatatcgcc
accgataatcaggcgctggtggaggcggcgtttatgcacctgaaggagaagggggtcaat
cgctttgccttttacggcctgccggcggaaggcggcaaacgctgggcgcaggagcgcgaa
caggctttccgccaacgggtggcggcggagcaatatcagggcgtggtgtatcagggcatg
gccaccgcgccggagaactggcagtacgcgcagaaccggctggcagattgggtgcagacc
ctgccgcaacagaccggcatcatcgccgtgactgacgcgcgggcgcgccatttgctgcag
gtgtgcgagcacctggatatcgcggtgccggagaaactctgcgtgatcggcatcgataac
gaagagctgacgcgctacctgtcgcgggtggcgctgtcgtcggtggcgcagggcactcgc
cagatgggttatcgcgccgccaagctgctgcatcagttgctggaccgccgcgaactgccg
ctgcaacgcatcctggtgccgccggtgaaggtgatcgaacgccgctccaccgatttccgc
tcgctgcgcgatccggcggtgattcaggccatgcattacatccgtcatcacgcctgcaag
ggcatcaaggtggagcaggtgctggacgcggtcggcatgtcgcgctccaacctggaaaaa
cgctttcgggacgagaccggcgcaaccatccaccatatgatccatcaggaaaagctggag
cgcgcccgtaatctgctgacggcgacctcgctgaccatcaacgagatctcgcagatgtgc
ggctacccgtcgctgcagtatttctattcggtgttcaaaaaaggctatgacgcaacgccc
aaagagtaccgcgaacgccacggtgaaaccggctattaa

DBGET integrated database retrieval system