KEGG   Serratia plymuthica 4Rx13: SOD_c00650Help
Entry
SOD_c00650        CDS       T02710                                 

Definition
(GenBank) glycerophosphoryl diester phosphodiesterase
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phytase-like
Motif
Other DBs
NCBI-ProteinID: AGO53101
UniProt: S0A813
Position
74313..75659
Genome map
AA seq 448 aa AA seqDB search
MHITKTRLALLAGCMALSSNLWADAQPAQAILAGHALLPVKSSISAPQDAPTDLRQSGKY
TSGKRVTELGSVAGKSADRMTGIGLPINGQPLQGHSGIKHMPDGTYWVLTDNGFGSKANS
PDAMLYLNHYKIDFSTGTVTPLKTVFLHDPDQKVPFHIINESTEKRYLTGSDFDPESFQF
ADNALWIGDEFGPYLIKADLDGKVLAVFDTKVDGKVVKSPDNPTLTLPGAPDGKQNFQVA
RSKGFEGMAASPDGSKLYPLLEGALWDGEKFENVDGKRYLRVLEFDVKQQAWTGRSWQYV
LEDNQNAIGDFNMIDATHGLVIERDNGEGTPDKACAAGAPTDNCFSQVAKFKRVYKIAFS
DANVGKPVEKLAYIDLLNIQDPNKLARKPLNDGVLTFPFFTIENVDVVDGSHIIVGNDNN
FPFSSSRQPNVADDNEFILLDVKDLLKP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcaccaaaacccgtttggcgctgttagccggctgtatggcattaagcagcaac
ctgtgggccgacgcgcagccggcgcaggcgatcctggccgggcatgcgctgctgccggtt
aaatccagcatctccgcgccacaggatgcgccgaccgatttacggcaaagcggcaaatac
accagcggcaaacgtgtcaccgaattgggcagcgtggcgggcaaatctgccgatcgcatg
accggcatcggcctgccgatcaacggccagccgttgcagggccattccggcatcaagcac
atgcccgacggcacttactgggtgctgactgacaacggctttggcagcaaggccaactcg
ccggacgccatgctgtatcttaatcactacaaaatcgacttcagcaccggcacggtcacg
ccgctgaagacggtattcctgcacgacccggatcagaaggtgcccttccatatcatcaat
gaaagcaccgaaaaacgttacctgaccggcagcgatttcgacccggaaagcttccagttc
gccgacaatgcgctgtggatcggcgacgaattcggtccttacctgatcaaggccgatctg
gacggcaaggtgctggcggtgttcgacaccaaggtggacggcaaggtggtgaaatcgccg
gacaacccgacgctgaccctgccgggcgcaccggacggcaaacagaacttccaggtggcg
cgttccaagggctttgaaggcatggcggcgtcgccggacggcagcaaactctacccgctg
ctcgaaggcgcactgtgggacggcgagaagtttgaaaacgtcgacggcaaacgctacctg
cgggtgctggagtttgacgtgaaacagcaggcatggaccggtcgcagctggcaatacgta
ctggaagacaaccagaacgccatcggcgatttcaatatgatcgacgccacgcacggcctg
gtgattgagcgcgacaatggcgaaggcacgccggacaaagcctgcgctgcgggtgcaccg
accgacaactgcttcagccaggtggcgaagttcaaacgggtgtataaaatcgccttctcg
gacgccaacgtcggcaaaccggtggaaaagctggcgtatatcgatctgctgaacattcag
gacccgaacaagctggcgcgcaaaccgctgaacgacggggtgctgaccttcccgttcttc
actatcgagaatgtcgatgtggtagacggtagccatattatcgtcggcaacgacaataac
ttcccgttctcttccagccgccagccgaacgtggcggacgacaacgaatttatcctgctg
gacgtgaaagatctgctgaagccttaa

DBGET integrated database retrieval system