KEGG   Serratia plymuthica 4Rx13: SOD_c00680Help
Entry
SOD_c00680        CDS       T02710                                 

Definition
(GenBank) hypothetical protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virulence_RhuM CFIA_Pcf11 Inhibitor_G39P
Motif
Other DBs
NCBI-ProteinID: AGO53103
UniProt: S0A7W1
Position
76321..76821
Genome map
AA seq 166 aa AA seqDB search
MPSLKETTLFFQTIQNKLHFACTGHTAAELIHQRADASQPHMGLSSYKGEEVRKSDVTVA
KNYLNQDEVRELNRVVNMWLDFAEDQARRRQQVFLRDWQVKLDQFLQFNDRDVLQGAGTV
SKKTADEKAQAEYVQFAEQQRRLKEAEGEKDIAGLLQWKTDTKKSP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgccgtcacttaaagagacaacgctgttttttcaaacaatccaaaacaagctgcatttt
gcctgcaccggccacactgctgccgaactcatccatcagcgtgctgacgccagccagcct
catatgggtttgagcagctataagggcgaagaggtgcgtaaaagcgatgtgacagtggcg
aaaaactaccttaaccaggatgaagtcagagagctcaaccgcgtagtcaacatgtggctg
gattttgccgaagatcaagcccggcgtcgtcagcaggtatttttgcgtgactggcaggta
aagctggatcagttcctgcaatttaatgatcgtgatgtgttacaaggcgcgggtactgtc
agcaagaaaacggcagatgaaaaagcgcaggccgaatacgtccagtttgctgagcaacaa
cggcgtttaaaagaagccgagggagaaaaggatattgccggtttactgcagtggaaaacc
gacactaaaaagtcgccttga

DBGET integrated database retrieval system