KEGG   Serratia plymuthica 4Rx13: SOD_c00690Help
Entry
SOD_c00690        CDS       T02710                                 

Definition
(GenBank) hypothetical protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porphobil_deamC
Motif
Other DBs
NCBI-ProteinID: AGO53104
Position
77301..77969
Genome map
AA seq 222 aa AA seqDB search
MLGSFIVNKMKVLGAGCALLVSASVLADDQDISIQGKPLQVVTADGKNHSLATCGDYLAL
RKNNQQITSISGLSDRDYMETQDTLIQCNIQNYAKQHQYVLDTQAGVPGIDQVVAHFPSS
AALVVSDDEVKVLKAKGQGKTLQQWTPTLKLKDDRMVSDKEQVAYAISQYQVFKRPQGKP
LTFITLGSAVTGGTLGTLSTYRIDDTSGKIWTITPVTENTSL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttagggagctttatcgtgaacaaaatgaaagtattgggtgccggttgtgccctgctg
gtttctgcgtcggttctggctgacgaccaggacatttccattcagggaaagccactgcag
gtggtcaccgcagacgggaaaaaccattctctggccacctgtggcgactatcttgctttg
cgtaaaaataaccagcagatcacttctatcagcggtttatcagatcgcgattatatggaa
acccaggacacgctgattcagtgcaatattcagaactatgcaaagcagcatcaatacgta
ctggatactcaagctggcgttccgggtattgatcaagtggtcgcacattttccttccagc
gccgctctcgtagtatcggatgatgaggtcaaggtactaaaagccaagggccagggtaaa
acgctgcagcaatggacacccacgctgaaattgaaggatgaccggatggtgtcggacaaa
gagcaagtcgcttacgccatcagccaatatcaggtattcaagcgcccacagggtaaacct
ttgactttcatcacactaggctctgctgttactggcggaacgctcggtacgctgtcgaca
tatcgtatcgatgacactagcggtaagatttggaccatcacgcctgttactgaaaatacc
tctttgtaa

DBGET integrated database retrieval system