KEGG   Serratia plymuthica 4Rx13: SOD_c00750Help
Entry
SOD_c00750        CDS       T02710                                 

Definition
(GenBank) hypothetical protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGO53110
UniProt: S0ABF8
Position
complement(85296..85895)
Genome map
AA seq 199 aa AA seqDB search
MRNKIGHNILGCLAALWLCSQSAQAQETLIFVRHGEKPANNSGQLTCKGLNRALALPQVL
LGRYGKPDFIFAAGPKENKSGSSLRALSTIMPTAVRAELPINIQFHADDIAGLEQALLSD
KYQNSRIFIAWEHKNLDKVVKSIVAARGGDANQVPKWPGSDFDSIFVVTLDNSGGVNKVS
FKQESEGLTHLAETCPSAG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacaagataggccacaacatactgggctgtttggcggcattgtggctgtgcagc
cagagcgcacaagcgcaggaaacgctgatcttcgtccggcacggggagaaacccgccaac
aacagcggccaactgacctgcaaggggttgaaccgcgcactggcattaccgcaggtgctg
ctgggccgctacggcaagccggactttatctttgccgccgggccgaaggagaacaaaagc
ggcagttcgctgcgcgctttgtctaccattatgcccaccgccgtgcgtgcagagctaccc
atcaacattcagttccacgccgacgacatcgctgggcttgaacaagcgctgctcagcgat
aaataccaaaactcgcgcattttcatcgcttgggaacacaagaacctcgacaaggtggtg
aaaagcatcgttgccgcacgcggtggtgatgccaatcaggtgcccaaatggccgggcagc
gacttcgacagcatttttgtggtcacgctggataacagcggcggagtgaataaggtgtca
tttaaacaggaaagtgaggggctgactcacttggcggagacctgcccatccgcagggtaa

DBGET integrated database retrieval system