KEGG   Serratia plymuthica 4Rx13: SOD_c00800Help
Entry
SOD_c00800        CDS       T02710                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_10 Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-ProteinID: AGO53115
UniProt: S0ABG3
Position
complement(90254..91003)
Genome map
AA seq 249 aa AA seqDB search
MTLRTEFGRILITGAGGRVATAFRQSVGDRYQLRLAERDINLLTGLHPGDEVISFDIANL
EACRAACANIDTVLHLAADPSPDADFCNSLKDNNILGTYNIFRAAKDAGCKRVVFASSAQ
AVEGYPLDYQIRPEDAPKPKNLYGVSKAFGEGIAAYFAYQEGLSALSVRIANFTTLEAGE
QLSARDMSAFLSHRDAADLLDRCVRIEGVHHAVVHGVSNNRYKRLSLEETSRLLGYYPQD
DAFSILGFA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacattgcgtactgagtttggacgaattttgattaccggcgcgggcgggcgggtcgcc
acggcattccgtcaatcggtgggcgatcgctatcaactgcggctggcggaaagggacatc
aacttgctgaccggcctgcaccccggcgatgaagtgatcagcttcgacattgccaatctc
gaagcctgccgtgcggcctgcgccaatatcgataccgtgctgcacctagccgccgacccc
tcccccgacgccgatttttgcaactctttgaaggataacaatatcctcggcacctacaat
attttccgtgcggcgaaagacgccggctgcaaacgcgtggtattcgccagcagcgcgcag
gctgtggaaggttatccgctggattatcagatacggccggaagacgcccccaaaccgaaa
aacctgtacggcgtcagcaaagcgttcggcgaaggcatcgccgcctattttgcctatcag
gaagggctttccgcgctgtcggtacgcatcgccaacttcaccacgctggaagccggcgag
cagctaagcgcccgtgacatgagcgcttttctcagccaccgcgacgccgccgatctgctg
gaccgctgcgtccgtattgaaggcgtgcaccatgcggtggtgcacggcgtctccaacaac
cgctataagcggctgtcgctggaagagaccagccgcctgctcggctactacccgcaagac
gatgcgttcagcattctgggcttcgcctaa

DBGET integrated database retrieval system