KEGG   Serratia plymuthica 4Rx13: SOD_c00820Help
Entry
SOD_c00820        CDS       T02710                                 

Gene name
fabG1
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase FabG
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00061  Fatty acid biosynthesis
srl00780  Biotin metabolism
srl01040  Biosynthesis of unsaturated fatty acids
srl01100  Metabolic pathways
srl01130  Biosynthesis of antibiotics
srl01212  Fatty acid metabolism
Module
srl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SOD_c00820 (fabG1)
   01040 Biosynthesis of unsaturated fatty acids
    SOD_c00820 (fabG1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SOD_c00820 (fabG1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    SOD_c00820 (fabG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:srl01004]
    SOD_c00820 (fabG1)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     SOD_c00820 (fabG1)
Lipid biosynthesis proteins [BR:srl01004]
 Fatty acid synthase
  Component type
   SOD_c00820 (fabG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase GDP_Man_Dehyd RmlD_sub_bind F420_oxidored NmrA
Motif
Other DBs
NCBI-ProteinID: AGO53117
UniProt: S0A9L5
Position
92074..92832
Genome map
AA seq 252 aa AA seqDB search
MDLQLRDRIALVTGASEGIGAGMVRVLAAQGVTVVATARREERLLALADEVERSGGTRPY
AIAADITDAAALDSMLAQAARLAGTIDILINAVGGARPTALSEGDAGWEEAFALNFTPAR
RVTHALLPGMQAQGWGRIINISGSMEPRSLNAATAAKGALHLWAKGLASELAAQGITVNT
LQPGRINSEQVREKLHPTEAARQAFIKQNIPIGYFGEPEDMAYLAAFLCSPLARYITGAV
IPVDGGMHYFAH
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcagttgcgggatcgtatcgcgctggtcaccggtgccagcgaaggcattggt
gccggtatggttcgggttctggcggcgcagggggtcaccgtggtggcgaccgcccgccgt
gaggaacgtttgctggctctggccgatgaggttgaacgaagcggcggcacgcggccctat
gcgatcgcggcggacatcaccgacgcggcggcgctcgacagcatgctggcgcaggcggca
cgcctggccgggacgattgatatcctgattaatgcggtcggcggcgctcgtccgaccgcg
ttgagcgaaggtgacgccggttgggaagaggcctttgccctgaactttacgccggcccgc
cgggtgacccacgcgctgttgcccggcatgcaagcgcaaggctgggggcgaatcatcaac
atcagcggctcgatggaaccgcgcagcctgaatgccgccaccgccgccaagggcgcactg
cacctgtgggccaaggggctggcaagcgagctggcggcgcagggcattaccgtcaatacg
ctgcaacccgggcggattaacagcgagcaggtgcgcgaaaaactgcatccgaccgaagcc
gcgcgccaggcgttcatcaagcaaaacatcccgatcggctactttggcgagccggaggac
atggcttacctggcggcgtttctttgttccccgctggcgcgctatatcaccggcgccgtg
atcccggtagacggcggcatgcactatttcgcccactga

DBGET integrated database retrieval system