KEGG   Serratia plymuthica 4Rx13: SOD_c00890Help
Entry
SOD_c00890        CDS       T02710                                 

Gene name
eptB1
Definition
(GenBank) phosphoethanolamine transferase EptB
  KO
K12975  KDO II ethanolaminephosphotransferase [EC:2.7.8.42]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00540  Lipopolysaccharide biosynthesis
srl01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SOD_c00890 (eptB1)
 09160 Human Diseases
  09168 Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SOD_c00890 (eptB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:srl01005]
    SOD_c00890 (eptB1)
Enzymes [BR:srl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.42  Kdo2-lipid A phosphoethanolamine 7''-transferase
     SOD_c00890 (eptB1)
Lipopolysaccharide biosynthesis proteins [BR:srl01005]
 Core region
  SOD_c00890 (eptB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase DUF1705
Motif
Other DBs
NCBI-ProteinID: AGO53124
UniProt: S0AAU6
Position
99891..101585
Genome map
AA seq 564 aa AA seqDB search
MNKVKSLSQQNLSLLLAIYIGIFLNLSVFYRRFDSFSHGIQGIKVISAVTEVIAIVLFTF
FVMRLISLGGRLFYRIIASLLVLISVAASYYMTFFNVVIGYGIVVSVMTTDIDLSKEVVG
MHFVLWMAVLSALPLLCIWKNNLRYTLIEQLKTPGHRVKPLMVLVAVVALVWLPLRMLDK
EQSAQEKITNVDLPSYGGVVAHSYLPSNWISALGLFAYTRYDESLDQANLFDPAKNFTYV
PPADIDDTYVVFIIGETTRWDHMGILGYDRDTTPRLSQEKNLVAFRGESCDTATKLSLRC
MFVREGGTSDNPQRTLKEQNVFAVLKNLGFTSELFAMQSEVWFYNNTEVDNYSFREMIAS
EKRNDGKSVDDMLLVDEMKESLSRYPKGKHMVILHTKGSHYLYSQRYPRSYARYQPECIG
VDDFCSKDQLVNAFDNSVLYTDSFIANVIDQVRDKKAIVFYSSDHGESIGENSHLHGTPR
EMAPPEQFRVPMMVWTSDKFLEDPQHRSAFEQLQAQQRIGKTHRHVELFDTILGCLGYTS
PDGGIVDKNNWCNIPQEKAAATPL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagttaaatcgctatcacagcagaatttatcgttattgttagcgatttatatc
ggcatctttttgaacctttccgttttttatcgtcgttttgattcgttttcgcacggtatt
cagggcattaaggttatctctgcggtcactgaagttatcgctatcgttctgttcaccttc
ttcgtcatgcggctgatatcgctgggcggccggctgttttaccgcatcatcgcttcgcta
ttggtgctgatttccgttgccgccagctattacatgacgttcttcaacgtggtgattggc
tacggcatcgtcgtctcggtgatgaccacggatatcgacctgtcgaaagaagtggtcggg
atgcatttcgtcctgtggatggcggtgctcagcgcattgccgctgctgtgcatctggaaa
aacaacctgcgctacacgctgatcgaacagctgaaaactcccgggcaccgggtgaaaccg
ctgatggtgctggtggcggtggtggcgttggtctggctgccgctgcgcatgctggacaaa
gagcaaagcgcccaggaaaaaatcactaacgtcgatctgccaagctacggcggcgtggtg
gcgcattcctacctgccatccaactggatctcggcgctggggctgtttgcctatacccgc
tacgacgaaagcctggatcaggccaatttgttcgatccggccaagaattttacctatgtg
ccgccggcggatatcgatgacacctacgtggtgttcattattggtgagaccacgcgttgg
gatcacatgggcattctcggctatgaccgtgataccacgccaaggctgtcgcaggagaaa
aacctggtggcgttccgcggtgaatcctgcgataccgcgaccaagctgtcgctgcgttgc
atgttcgtgcgcgaaggcggcacgtcggacaacccgcagcgcacgctgaaagaacaaaac
gtgtttgcggtgctgaaaaacctgggcttcacctccgagctgttcgccatgcagagcgag
gtctggttctacaacaataccgaagtggacaactattcgttccgcgagatgatcgcctcc
gagaaacgcaacgacggcaaatcggtcgacgacatgctgctggtggacgaaatgaaagag
tcgctgtcgcgttacccgaaaggcaagcatatggtgatcttgcacaccaaaggctcgcat
tatctctattcgcagcgttatccgcgcagctacgcgcgctatcagccggagtgcatcggc
gttgacgacttctgttccaaagatcagctggttaacgccttcgataactcggtgctgtat
accgacagctttatcgccaatgtgatcgaccaggtgcgcgataagaaggcgattgtgttc
tattcgtccgatcacggcgagtcgataggcgagaattcacacctgcacggtacgccgcgc
gaaatggcgccgccggagcaattccgcgtgccgatgatggtatggacctccgacaagttc
ctggaagacccgcagcaccgcagcgcgtttgagcaactgcaggcgcagcagcgtatcggc
aagacccaccgtcacgtcgagctgtttgataccattctcggttgcctcggttacacctcg
ccggatggcggcatcgtggataaaaacaactggtgcaacatcccgcaggaaaaagcggcg
gcgaccccgctgtaa

DBGET integrated database retrieval system