KEGG   Serratia plymuthica 4Rx13: SOD_c00940Help
Entry
SOD_c00940        CDS       T02710                                 

Gene name
chiA
Definition
(GenBank) chitinase A
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00520  Amino sugar and nucleotide sugar metabolism
srl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SOD_c00940 (chiA)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     SOD_c00940 (chiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_18 ChitinaseA_N PKD DUF1539
Motif
Other DBs
NCBI-ProteinID: AGO53128
Position
106132..107823
Genome map
AA seq 563 aa AA seqDB search
MRKFNKPLLALLIGSTLCSAAQAATPGKPTLAWGNTKFAIVEVDQAATAYNNLVKVKTAA
DVSVSWNLWNGDTGTTAKVLLNGKEVWSGASTGASGTANFKVSKGGRYQMQVALCNAEGC
TASDATEIVVADTDGSHLAPLKEPLLEKNKPYKQDSGKVVGSYFVEWGVYNRNFTVDKIP
AQNLTHLLYGFIPVCGGDGINDSLKEIEGSFQALQRSCQGREDFKVSIHDPFAALQKGQK
GVTAWDDPYKGNFGQLMALKQARPDLKILPSIGGWTLSDPFFFMGGKVKRDRFVGSVKEF
LQTWKFFDGVDIDWEFPGGQGANPKLGSAQDGATYVQLMKDLRAMLDQLSAETGRKYELT
SAISAGKDKIDKVDYNTAQNSMDHIFLMSYDFYGAFDLKNLGHQTALKAPAWKPDTAYTT
VNGVNALLAQGVKPGKIVVGAAKYGRGWTGVSGYQNNNPFTGTATGPVKGTWENGIVDYR
QIANEFMSGEWQYNYDATAEAPYVFKPSTGDLITFDDPRSVQAKGKYVLDKQLGGLFSWE
IDADNGDILNNMNTSLGNSAGAQ
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaatttaataaaccgctgttggcgttgctgatcggcagcacgctgtgttctgcg
gcgcaggccgctacgccgggcaagcccacgctggcctggggcaataccaagttcgccatt
gtcgaggttgatcaggcggcgacggcttataataatctggtgaaagtaaaaactgccgcg
gatgtttccgtttcatggaatttatggaatggcgataccggcaccacggcaaaagtgtta
ttaaacggcaaggaagtttggagcggtgcctcaaccggcgcttcgggcacggcaaacttt
aaggtgagtaagggcggccgttatcaaatgcaggtggcattatgtaatgccgagggctgc
accgccagcgacgcgacagaaattgtggtggcggataccgacggcagccatttagcgccg
ttaaaagaaccgttactggaaaaaaataaaccttataaacaagactccggcaaagtcgtc
ggttcttatttcgttgaatggggcgtttataaccgtaacttcaccgtcgataaaattccg
gcgcagaacctgacgcacctgctgtacggctttatcccggtctgcggcggtgacggcatt
aacgacagtctcaaagagatcgaaggcagtttccaggcgctgcaacgttcctgccagggc
cgtgaagacttcaaggtgtcgatccacgatccgttcgccgcgctgcagaaagggcaaaag
ggcgtcaccgcctgggatgacccctacaaaggcaacttcggtcagttgatggcgctcaaa
caggcgcgtcccgatctgaaaatcctgccgtctatcggcggctggacgctgtccgacccg
ttcttctttatgggcggtaaggtgaagcgcgatcgcttcgtcggttcggtgaaagagttc
ctgcagacctggaagttctttgacggggtggatatcgactgggaattcccgggcgggcag
ggcgctaacccgaaactgggcagcgcgcaggacggggcgacctatgtgcagttgatgaaa
gatctgcgtgccatgctggatcagctttcggcggaaaccggccgcaagtatgagctgacc
tccgccatcagcgccggtaaggacaagatcgacaaagtggattacaacaccgcgcagaac
tcgatggaccacatcttcctgatgagctacgacttctatggcgcttttgatctgaaaaat
ctgggccaccagaccgcgctgaaagcgccggcctggaaaccggacacggcttataccacg
gttaacggcgtcaatgcgttgctggcgcagggcgtgaagccgggcaaaattgtggtgggt
gcggccaagtacggccgtggctggaccggcgtgagcggttaccagaacaacaatccgttt
accggcaccgccaccgggccggtgaaaggcacctgggaaaatggcatcgtggattaccgt
cagatcgccaacgagtttatgagtggcgaatggcagtacaactatgacgccaccgcagaa
gcgccttatgtgttcaagccgtctaccggcgacctgatcaccttcgacgatccgcgctcg
gtgcaggcgaaaggcaagtatgtgctggataagcagttggggggattgttctcttgggaa
attgacgccgacaacggggatattctgaacaatatgaataccagcctgggtaatagtgcc
ggcgcgcaataa

DBGET integrated database retrieval system