KEGG   Serratia plymuthica 4Rx13: SOD_c00950Help
Entry
SOD_c00950        CDS       T02710                                 

Gene name
dppA1
Definition
(GenBank) periplasmic dipeptide transport protein DppA
  KO
K12368  dipeptide transport system substrate-binding protein
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl02010  ABC transporters
srl02030  Bacterial chemotaxis
Module
srl_M00324  Dipeptide transport system
Brite
KEGG Orthology (KO) [BR:srl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SOD_c00950 (dppA1)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    SOD_c00950 (dppA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srl02000]
    SOD_c00950 (dppA1)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Dipeptide transporter [MD:M00324] [OT]
    SOD_c00950 (dppA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AGO53129
UniProt: S0AAV0
Position
108425..110032
Genome map
AA seq 535 aa AA seqDB search
MTSSLGKTGILKFGIGLIALTVAASVQAKTLVYCSEGSPEGFNPQLFTSGTTYDASSVPI
YNRLVEFKIGTTELEPGLAEKWDVSEDGKTYTFHLRKGVKWQSNKDFKPTRDFNADDVVF
SFERQLDANNAYHKVSGGSYEYFEGMDMPKLIAKIEKVDDNTVRFVLNRPESPFLADLGM
DFASILSAEYADNMMKAGTPEKVDLNPVGTGPFQLLQYQKDSKILYKAFDGYWGTKPKID
RLVFSITPDASVRYAKLQKNECQVMPFPNPADIARMKQDKTINLMEKPGLNVGYLSFNVE
KKPLDNLKVRQALTLAVNKQAIIDAVYQGAGQAAKNLIPPTMWGYNDAVKDYTYDPVKAK
ELLKEAGMADGFAIDLWAMPVQRPYNPNARRMAEMVQNDWAKIGVKAKIVTYEWGEYLKR
AKAGEHQTVMMGWTGDNGDPDNFFATLFSCAAAKDGSNYSRWCYKPFEDLIQPARAEPNH
DKRVELYKQAQVVMHDQAPALIVAHSTVYEPVRKEVKGYVVDPLGKHHFENVSLD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgacaagttccttgggaaaaacagggattctgaaattcgggattgggctgattgcgttg
accgtagcggccagcgtacaagccaaaacgttggtttactgttctgaagggtccccggaa
gggttcaacccgcaactgttcacctcgggtaccacctatgatgccagctcggtgcccatc
tataaccgtttggtcgaattcaaaatcggcaccaccgaactggagccgggcctggccgaa
aaatgggacgtcagcgaagacggcaaaacctacactttccacctgcgtaaaggcgtgaag
tggcagagcaacaaagacttcaaaccgacccgcgattttaacgccgacgacgtggtgttc
tcgttcgaacgtcagttggacgcgaacaatgcctaccataaagtctctggcggcagctat
gagtactttgaaggcatggacatgccgaagttgatcgccaaaatcgaaaaagtggacgat
aacaccgtgcgcttcgtgctgaaccgtccggagtcgccgttcctggccgatctgggcatg
gacttcgcgtccatcctgtcagccgaatacgccgacaacatgatgaaagccggcacgccg
gaaaaagtggacctgaacccggtcggtaccggcccgttccagctgctgcaataccagaaa
gactccaaaatcctgtacaaggcatttgacggttactggggcaccaagccgaagatcgac
cgtttagtcttctccattacgcctgacgcttccgtgcgttacgccaagctgcagaaaaac
gagtgccaggtgatgcctttcccgaacccggccgatatcgctcgtatgaagcaggacaaa
accatcaacctgatggaaaaaccggggctgaacgtcggttatctgtcgttcaacgtcgag
aaaaaaccgctggataacctgaaagtgcgtcaggcgctgaccctggcggtcaacaaacag
gcgatcatcgacgcggtgtatcagggggcgggccaggcggccaagaacctgatcccaccg
accatgtggggctataacgacgcggtgaaggattacacttacgatccggtcaaggccaaa
gaactgctgaaagaagccggtatggctgacggtttcgccatcgatctgtgggcgatgccg
gtacagcgtccgtataacccgaacgcgcgtcgcatggcggaaatggtccagaacgactgg
gcgaaaatcggcgtgaaagccaaaatcgtgacctatgagtggggcgaatacctcaagcgc
gccaaggcgggcgaacatcagacggtgatgatgggctggaccggcgacaacggggatccg
gataacttcttcgccacgctgttcagctgcgccgcagcgaaagacggctccaactactcc
cgctggtgctacaagccgtttgaagatctgattcaaccggcgcgcgccgaaccaaaccac
gacaaacgcgtagaactgtacaaacaggctcaggtcgtgatgcacgatcaggctccggcg
ctgattgttgcccactccaccgtttatgagcccgtgcgtaaagaagtgaaaggctacgtc
gtggatccgcttggcaagcatcactttgagaacgtctctctagattga

DBGET integrated database retrieval system