KEGG   Serratia plymuthica 4Rx13: SOD_c00970Help
Entry
SOD_c00970        CDS       T02710                                 

Gene name
dppC
Definition
(GenBank) dipeptide transport system permease protein DppC
  KO
K12370  dipeptide transport system permease protein
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl02010  ABC transporters
Module
srl_M00324  Dipeptide transport system
Brite
KEGG Orthology (KO) [BR:srl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SOD_c00970 (dppC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srl02000]
    SOD_c00970 (dppC)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Dipeptide transporter [MD:M00324] [OT]
    SOD_c00970 (dppC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N DUF624
Motif
Other DBs
NCBI-ProteinID: AGO53131
UniProt: S0A835
Position
111232..112134
Genome map
AA seq 300 aa AA seqDB search
MSQVTEPVVKGAPKPMSPFQEFWHYFKRNRGAVVGLVYIVLMFVIAIGAGVLAPHAPADQ
FRDALLRPPAWQEGGSWQYFLGTDDVGRDVLSRLMYGARLSLLVGCLVVVLSLIMGVVLG
LLAGYFGGVVDAVIMRIVDIMLALPSLLLALVLVAIFGPSIVNASLALTFVALPHYVRLT
RAAVLVEVNRDYVTASRVAGAGAMRQMFINILPNCLAPLIVQASLGFSNAILDMAALGFL
GMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGVAILLTVLAFNLMGDGLRDALDPKLKQ
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagtcactgagcctgttgttaaaggtgcgccgaagcccatgagcccgttccag
gagttctggcactatttcaagcgcaacagaggggccgttgtcggcctggtttatatcgtt
ttgatgtttgtgattgctattggcgccggcgtactggcaccgcatgccccggcggatcag
ttccgcgacgcgctgctcaggccaccggcctggcaggaagggggcagttggcagtatttc
ctcggtaccgacgatgtgggccgagatgtgctgtcgcgcctgatgtacggtgcgcggttg
tcattgctggtcggttgcctggtggttgtgctgtcgctgatcatgggcgtggtgctgggc
ctgctggccggctacttcggcggcgtggtagatgccgtcatcatgcgtatcgtcgacatc
atgctggcgctgccaagcctgctgctggcgctggtactggtggcgatcttcggcccgtcg
atcgtcaacgcctcgctggcgctgaccttcgtcgccctgccgcactatgtgcgtctgacc
cgcgcggcggtgctggtggaagtgaaccgcgactacgttactgcctcacgcgtggcgggc
gccggtgcgatgcgccaaatgttcatcaacattctgccaaactgcctggcacccttgatc
gtccaggcctctcttggcttctcgaacgccattctggatatggccgctctcggctttctg
ggcatgggtgcgcaaccgccaacgccggagtggggcaccatgctctccgacgtgctgcag
ttcgcccaaagcgcctggtgggtcgtgaccttccccggcgtggcgattctgctgacggtg
cttgcattcaacctgatgggggacggcttgcgtgatgctctcgaccccaaactcaagcag
taa

DBGET integrated database retrieval system