KEGG   Serratia plymuthica 4Rx13: SOD_c01010Help
Entry
SOD_c01010        CDS       T02710                                 

Gene name
bcsF
Definition
(GenBank) cellulose biosynthesis protein BcsF
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBP_BcsF
Motif
Other DBs
NCBI-ProteinID: AGO53135
UniProt: S0ABH9
Position
complement(116110..116313)
Genome map
AA seq 67 aa AA seqDB search
MLNLNDIVQLILLCAIIFIPLGYFFHRRFPRWRQYWQNLFLSPRYLKPTGLWVREGSSSQ
IKRKKQP
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaccttaacgatatcgtgcagttgattctgctgtgcgcgatcatttttattccg
ctggggtacttctttcatcgccgtttcccgcgctggcgtcaatattggcaaaacctgttt
ttatcaccgcgctatttaaaacccaccgggttatgggtgcgcgaaggttcttcatctcag
attaagcgtaaaaaacagccatga

DBGET integrated database retrieval system