KEGG   Serratia plymuthica 4Rx13: SOD_c01080Help
Entry
SOD_c01080        CDS       T02710                                 

Gene name
yhjK
Definition
(GenBank) protein YhjK
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL GAPES3 GGDEF HAMP
Motif
Other DBs
NCBI-ProteinID: AGO53142
UniProt: S0A9R5
Position
128801..130807
Genome map
AA seq 668 aa AA seqDB search
MRVRRSLTIKQMATVSGVALVTICIFIVIQLFHFVQQRRDDYAQQLENIAHSVRQPLAEA
VLRMDVPETKRVLNTLLPVGILTRADIVLPNEFQALHANFPPERPVPTLIARLFELPIQI
SVPLYSLERVPANPQPLAYLVLQADSFRMYQFILSMLSTMLSTYLLLALILSVAISWCMN
RLMVHPLRAMAKELENISQDEAPYHQLMLPALHQDDELGLLVRNYNRNQQRLAKAYAEMS
RLSTRHPVTELPNQALFTALLEQHIASSLRPDRFNLLVIGIETLHEASGVLNPAMREALL
LTLAKKLRECIDENGVLAQLSNTEFAILAKGVERPFHAMQLARRIMAQINAPLSLQEMPL
RPSASIGIAHYLNVGESAEQLLRSATSAMMSAHREGKNQILFFEPSLTERTQKRLTQESE
ILHAIDQRRFTLFLQPQMDMQSNAVIGAEALLRWQQYDGSFTLPADVIPLAEELGVIVPL
GNWVLEESCRILADWQTRGITLPLAVNISATQMQHEDFIPHLKSMLAQHHIDPRKLLLEI
TETVRIDDLDRALSLLRELHDLGLSIALDDFGMGYSSLNYLNRLKCLPIDLIKIDKSFIQ
GLPADDAMVRIVSSISEVLHLPVMAEGVENAGQRDWLLQHGIHSGQGFLFARPLPRAEFE
AQFCQPPA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggtcaggcgttcattaacgattaaacagatggcaacggtgtccggcgtggcgctg
gtgacgatctgcatatttatcgtgatccagttattccactttgtgcagcagcgcagggat
gactatgcccagcaactggaaaacattgcgcattccgtacgccaaccgctggcggaagcc
gtactgcgcatggacgtgccggaaaccaagcgggtgctgaatactctgctgccggtgggc
atattgacccgtgcggatatcgtgctgccgaatgaatttcaggcactgcacgccaacttc
ccgccggaacgtccggtacctacgttgatcgcccgtctcttcgagctgccgatccaaatt
tccgttccgctctattcgctggagcgcgtgcccgccaacccgcagcccctggcttatctg
gtgctgcaggccgattcgtttcgcatgtaccaattcattctcagcatgttgtcgaccatg
ctgtcgacctatttgctgctggcattgattctgtcggtcgctatcagctggtgtatgaac
cggttgatggtgcatccgttgcgcgccatggcgaaagagctggaaaatatttcgcaggac
gaagcgccgtatcaccaactgatgctgccggccctgcaccaggacgatgagctggggttg
ctggtgcgcaattacaaccgcaatcagcagcggctggcaaaagcctatgccgagatgagc
cgcctgagcacgcgccatccggtaaccgagctgcccaaccaggcgctgtttaccgccctg
ctggaacagcatatcgcctccagtctgcgccccgatcgcttcaacctgctggtcattggc
attgagacgctgcatgaggcatccggcgtgctcaatccggcgatgcgcgaagcgctgttg
ctgacgttggcgaagaagctgcgcgagtgtattgatgagaacggcgtgctggcgcaactg
agcaacaccgagttcgccattttggccaaaggcgttgagcgaccgttccacgccatgcag
ttggcgcgccgcattatggcgcagatcaatgcgccgctgagcctgcaggaaatgccgttg
cggccaagcgccagcatcggcatcgcccactatctcaatgtcggggagagtgcggaacag
ctgctgcgcagcgccacttcggcgatgatgtcggcgcatcgtgaaggcaagaaccagatc
ctgttctttgagccgagcctgacggagcgtacccaaaagcggttgacgcaggaaagtgaa
attctgcacgccattgatcaacgccgtttcaccctgtttttgcagccgcagatggatatg
cagtccaatgcggtgatcggcgccgaggcgctgctgcgttggcagcagtacgacggcagc
tttactctgccggcagacgtcattccgttggccgaggagcttggcgtgattgtgccgctc
ggcaactgggtgctggaggagtcctgccgcattctggcggactggcagaccagaggcatt
acgctgccgttggcggtcaatatttccgccacccagatgcagcatgaagactttattcca
cacctgaagagcatgttggcgcagcatcatattgatccgcgcaagctgctgctggaaatt
accgaaacggtgcgcattgacgatctcgatcgtgcgttgtcgctgttgcgggaactgcac
gacctggggctgtcgattgcgctggacgattttggtatgggatattccagccttaattac
cttaaccgcctgaaatgcctgccgatcgatttgattaaaatcgacaagagttttattcag
ggattgccggcggatgacgcgatggtgcgtatcgtcagttcgatttctgaggtgctgcat
ctgccggtgatggctgaaggcgtcgaaaatgccgggcagcgcgactggctgttgcagcac
ggtattcacagtggtcaggggttcctgtttgcccgtccgttgccgcgcgcggaatttgaa
gctcagttctgccaaccgccagcttaa

DBGET integrated database retrieval system