KEGG   Serratia plymuthica 4Rx13: SOD_c19000Help
Entry
SOD_c19000        CDS       T02710                                 

Gene name
cscA
Definition
(GenBank) sucrose-6-phosphate hydrolase CscA
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00052  Galactose metabolism
srl00500  Starch and sucrose metabolism
srl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SOD_c19000 (cscA)
   00500 Starch and sucrose metabolism
    SOD_c19000 (cscA)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SOD_c19000 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGO54877
UniProt: S0AEI6
Position
complement(2067292..2068734)
Genome map
AA seq 480 aa AA seqDB search
MNNALAQADHAVETLRAQRQDDYYPRFHLAPAAGWINDPNGLVYINGVYHAFYQHHPYDE
NWGPMHWGHAISRDLAHWQHQPIALAPGDDYDKDGCFSGCAVDDNGVLTLIYTGHVWLDK
VGDDDQVREVQCLATSEDGVHFVKHGPVLAPPEGIQHFRDPKVWRENDGWWMVVGAKQNG
LGQARLYRSKDLRDWQFDRVLDGAQTLHQGYMWECPDFFPLGEKQVLLFSPQGLAAQGYR
HRNRFQSGYLLGHWQPGADFNVTQPFCELDAGHDFYAPQTFTAADGRRLLFAWMDMWESP
MPSKAHGWAGALTLPRELTLNAEGDVLMNPARELAALRGLPQRFAAAQLRNQRQLLAENL
QELTLSLDLAASDAERYGIAIGDAARLYVDNQAHRLVLERFSEEPGLCGCRSVPLPAGDM
LSLNLFIDRSSLEVFVNQGVACLTSRIYPTDGQRGVSLFAESGQAQFEALQGWELASIWA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgccttagctcaagccgaccatgcggtcgaaaccctgcgcgcacagcgtcag
gacgattactacccgcggtttcatctggcgcctgccgccggctggatcaacgatcccaat
gggctggtgtacattaacggcgtttatcatgcgttctatcagcatcacccctacgacgaa
aactgggggccgatgcactggggccatgccatcagccgggatctggcgcactggcagcac
cagccgatagccctggcgcccggcgacgactacgacaaagacggctgtttctccggctgc
gcagtggacgataacggcgtgctgacgctgatctacaccggccacgtctggttggacaaa
gttggcgatgacgatcaggtgcgcgaggttcagtgcctggccaccagcgaggacggcgta
catttcgtcaaacacggaccggtgctggcaccgccggaagggattcagcatttccgcgat
cccaaggtctggcgcgagaatgacggctggtggatggtggtcggcgccaaacaaaacgga
ctcgggcaggcacggctttatcgttcaaaagatctgcgtgactggcagtttgaccgcgtg
ctggacggcgcgcagacgttgcatcagggctatatgtgggagtgcccggatttcttcccg
ctcggcgaaaaacaggtactgctgttctcgccgcaggggctggcggcgcaggggtaccgc
caccgtaaccgcttccagagcggctatttgctcggtcactggcagccgggcgccgatttc
aacgtcactcaacctttctgcgagctggacgccgggcatgatttctatgcgccgcaaacg
ttcaccgccgccgacggccgccgcctgctgttcgcctggatggacatgtgggaatcgccg
atgccgagcaaggcgcacggttgggccggtgcgctcaccctgccccgcgaactgacgctg
aatgccgaaggcgatgtgctgatgaacccggcgcgggagttggcggcgctgcgcggcctg
ccgcagaggtttgccgcagcgcaactgcgcaaccaacgccagcttctggcggaaaacctg
caagagctgacgctgtcgttggatctggccgccagcgatgccgaacgctacggtatcgcc
attggcgacgccgcccggctgtacgtggacaaccaggcccacaggctggtgttggagcgt
ttcagcgaggaaccgggtctgtgcggttgccgcagcgtgccgctgccggcgggcgacatg
ctgtcgctgaacctgtttatcgaccgttcatcgctggaagtgttcgtcaatcagggcgtt
gcctgcctgaccagccgcatctacccgaccgatggccagcgcggcgtgagcctgtttgcc
gaaagcggccaggctcagtttgaagcgttacaggggtgggaactggcgagcatctgggcc
tga

DBGET integrated database retrieval system