KEGG   Serratia plymuthica 4Rx13: SOD_c19030Help
Entry
SOD_c19030        CDS       T02710                                 

Gene name
gutB
Definition
(GenBank) sorbitol dehydrogenase GutB
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SOD_c19030 (gutB)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SOD_c19030 (gutB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SOD_c19030 (gutB)
    1.1.1.-  
     SOD_c19030 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AGO54880
Position
complement(2070978..2071967)
Genome map
AA seq 329 aa AA seqDB search
MKAARFYGVGDLRIEDIAPPSALPDDAVRVRVLAAGICGSDLHNFRTGQWIGPLPVTPGH
EFCGEVLAIGSAVSRFAVGDRVVADSRVGCGHCAACQSGRHNLCRSLGFVGEVCDGGFAE
QVQLPASRLLRVPDTLPAAIAALSEPLGVALRVVNQLNPPPGEPVLIAGGGTIGGLVALL
LHHLRGCPLLVAESNPLRLTVLSQVLPLQAVELDHDLPLAAAYAVEATGVTGVLNQLINL
VTPGGRIAMVGLFHGQAAIDANRLVEREISLIGCSVFADEQRSAISLLPQLAGELAHWIS
RPIPLDALPDTYRQLLAGRVGALKTLVVP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcacgtttttatggcgtaggcgacctgcgcatcgaagacatcgccccgccg
tccgccctgcccgacgatgcggtacgcgtgcgggtgctggccgccggtatttgcggttcc
gacctgcataacttccgcaccgggcaatggatcggtcctctgccggtcacccccggtcat
gagttctgcggtgaagtgttggcgatcggcagcgcagtaagccgctttgccgttggcgac
cgggtggtggccgactcacgcgtcggttgcggccactgtgccgcctgccaaagcgggcgt
cacaacctgtgccgttcgctgggttttgtcggcgaagtctgcgacggcggctttgccgaa
caagtgcagttgccggcctcacggctgctgcgggtaccggataccctgccggcggcgatt
gccgccctgagcgagccgcttggcgtggcactgcgggtggtgaatcagttgaacccgccc
cccggagaaccggtgttgatcgccggtggcggcaccataggcgggttggtcgccttgtta
ttgcaccatctgcgcggctgcccgttgctggtggcggagtccaacccgctgcggctgaca
gtgctcagccaggtgctgccgctacaggcggtggagctggatcacgacttaccgctggcg
gcagcctacgcggtggaggccaccggcgttaccggagtattgaatcaactgattaacctc
gtcaccccaggcggccgcattgccatggtcggtctgtttcatgggcaggcggcaatcgat
gccaataggctggtggagcgcgagatttcgctaatcggttgcagcgtgttcgccgatgag
caacgcagcgccatcagcctgttgccgcagttggccggcgaactggcgcactggatatcc
cggccgatccctctcgacgccctgccggatacctatcggcaattgttggcggggcgcgtc
ggagcgctgaaaaccctggtggttccctga

DBGET integrated database retrieval system