KEGG   Serratia plymuthica 4Rx13: SOD_c29300Help
Entry
SOD_c29300        CDS       T02710                                 

Gene name
bdhA
Definition
(GenBank) (R,R)-butanediol dehydrogenase BdhA
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SOD_c29300 (bdhA)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SOD_c29300 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SOD_c29300 (bdhA)
    1.1.1.-  
     SOD_c29300 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 Shikimate_DH F420_oxidored 2-Hacid_dh_C NTP_transf_3 ApbA Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: AGO55901
Position
3272980..3274035
Genome map
AA seq 351 aa AA seqDB search
MKAARWYQARDIRIDDIEEPQVSAGKVKIKVAWTGICGSDLHEYLAGPIFAPVGKPHKLS
HDIAPIVMGHEFSGEVVDVGRGVTKFKAGDRVVVEPILACRQCEACREGKYNLCADLGFH
GLSGGGGGFSSFTMVDEHMVHRMPDALSYEQGALVEPAAVALHAVRMSKLKAGDKAAVFG
AGPIGLLVIEALRAAGAAEIYVVELSPQRAEKARELGAKVVIDPSKDDAVATIRELSAGG
VDVAFEVTGVPVVLKQCIDSTRYEGETIIVSIWEGEAAFHPNKVVLSERSVKGIIAYRHI
FPAVMDLMTQGYFQADKLVTKRIELADLVEQGFEALVKEKQQVKILVRPPQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctcgttggtatcaggcgcgcgacatccgtattgatgatattgaagaacct
caggtttccgccggtaaggtgaaaatcaaggtagcctggaccggaatttgcggcagcgac
ctgcacgaatacctcgccggaccgatttttgccccggtaggcaaacctcacaagctaagc
catgacatcgcgcctatcgtcatgggccatgagttttccggtgaagtggtggacgtgggt
cgcggcgtgacgaaattcaaagccggcgaccgcgtggtcgtagagccgatcctggcttgt
cggcagtgcgaagcctgccgcgaaggcaaatataacctgtgcgccgatctgggtttccac
ggtctgtccggcggtggcggcggcttctcctcctttaccatggtagacgagcatatggta
caccgcatgcccgatgcgctcagctatgagcaaggtgcgttggtagagcctgcggcggta
gcccttcatgcggtgcggatgagcaaattgaaagccggggataaagcggccgtcttcggt
gccggccccatcggcctgctggtgattgaagcattgcgcgcggccggtgcggcagaaatt
tatgtggtcgagctgtcacctcagcgggcagaaaaagcgcgtgaactgggagcgaaagtg
gtgatcgaccccagcaaagacgatgccgtcgccacaatacgcgagctgagcgcgggtggc
gttgacgtggcgtttgaagtgaccggcgtgccggtggtgctaaaacagtgtatcgacagc
actcgctacgaaggcgagacgattatcgtctccatctgggaaggggaagcggcattccat
ccgaacaaagtggtgctcagcgaacgttcagtcaaagggattatcgcttatcgccatatt
ttcccggcggtgatggatctgatgacccagggctacttccaggccgacaagctggtgacc
aagcgtatcgaactggctgatttggtggagcagggttttgaagcgctggtgaaagaaaaa
caacaggttaaaatcctggtgcgtccaccgcagtaa

DBGET integrated database retrieval system