KEGG   Serratia plymuthica 4Rx13: SOD_c35470Help
Entry
SOD_c35470        CDS       T02710                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase Ndk
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00230  Purine metabolism
srl00240  Pyrimidine metabolism
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01130  Biosynthesis of antibiotics
Module
srl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
srl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
srl_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
srl_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SOD_c35470 (ndk)
   00240 Pyrimidine metabolism
    SOD_c35470 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srl04131]
    SOD_c35470 (ndk)
Enzymes [BR:srl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SOD_c35470 (ndk)
Membrane trafficking [BR:srl04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SOD_c35470 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AGO56505
Position
complement(4005243..4005668)
Genome map
AA seq 141 aa AA seqDB search
MTVERTFSIIKPNAVANNDIGAIYARFERAGFKIIASKMLRLTREQAEGFYAEHKGRPFF
DGLVEFMTSGPIVVQVLEAENAVQRNRDIMGATNPDNALAGTLRADYADSFTANAVHGSD
AVESAQREIAYFFNESEICPR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtagaacgtaccttttccattatcaaaccaaatgctgtagccaataacgacatc
ggcgcaatctacgctcgtttcgagcgtgccggtttcaaaatcatcgcatccaaaatgctg
cgtctgactcgcgaacaagccgaaggcttctacgctgagcacaaaggccgcccattcttc
gacggtctggttgagttcatgacttcaggcccaatcgtggttcaggttctggaagctgaa
aacgcagtacagcgcaaccgtgacatcatgggcgcaaccaacccggacaacgcactggca
ggcaccctgcgtgcagactacgcggacagcttcacagccaacgccgtgcacggttctgac
gcagtagaatctgcccagcgcgaaatcgcttacttcttcaacgaaagcgaaatctgccca
cgctaa

DBGET integrated database retrieval system