KEGG   Serratia plymuthica 4Rx13: SOD_c37610Help
Entry
SOD_c37610        CDS       T02710                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:srl03016]
    SOD_c37610 (truC)
Enzymes [BR:srl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     SOD_c37610 (truC)
Transfer RNA biogenesis [BR:srl03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    SOD_c37610 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AGO56714
Position
complement(4233234..4234007)
Genome map
AA seq 257 aa AA seqDB search
MIEILYQDEHLVAVNKPSGWLVHRSWLDRHETRFMMQTVRDQIGQHVFTVHRLDRPTSGV
LLMALSSEVARLLSQQFEQHQVQKTYHAVVRGYVQEGATLDYPLTEELDKIADKHTAVDK
GPQPAVTHYRPLAQVEMPVAIGRYDSARYSLMELKPENGRKHQLRRHMVHLRHPIIGDSK
HGDLRQNRGMAQHFGCPRLMLHASHLQLNHPVTGEPLPISARWDEPWQGVMSQFGWAGVF
PELAGVEFSAANGQDNG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgattgagattctttaccaggatgagcatttggtggcggtgaacaagccgtcgggctgg
ctggtgcatcgcagttggctggatcgtcacgaaacccggtttatgatgcagacggtgcgt
gaccagataggtcagcacgtgtttaccgtgcatcgcctcgaccgcccgacctccggcgtg
ctgttgatggcgctgtccagcgaagtggcgcgtctgctgtcgcagcagttcgagcagcac
caagtgcagaaaacctatcatgcggtggtgcgtggctacgtgcaggaaggggcaactctc
gactacccgctgacggaagaactggacaaaatcgccgataagcataccgccgtcgataaa
ggtccgcagccggcggtcacccactaccggccgctggcgcaggtggagatgccggtggcc
attggccgttatgacagcgcgcgctacagcttgatggagctgaagccggaaaacggccgt
aagcatcagttgcgtcgccatatggtgcatcttcgtcatccgatcattggtgacagtaag
cacggcgacctgcgtcagaaccgcggcatggcccagcacttcggctgcccgcgcttgatg
ctgcacgccagtcatctgcagttgaaccatcctgtgaccggtgagccgttacctatttcc
gcacgctgggatgaaccctggcagggagtcatgtcgcagtttggctgggcaggggttttc
cctgagctcgccggggttgagtttagtgcggctaacggtcaggataacgggtaa

DBGET integrated database retrieval system