KEGG   Serratia plymuthica 4Rx13: SOD_c40520Help
Entry
SOD_c40520        CDS       T02710                                 

Gene name
scrB
Definition
(GenBank) sucrose-6-phosphate hydrolase ScrB
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00052  Galactose metabolism
srl00500  Starch and sucrose metabolism
srl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SOD_c40520 (scrB)
   00500 Starch and sucrose metabolism
    SOD_c40520 (scrB)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SOD_c40520 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGO57002
UniProt: S0AKG0
Position
4579243..4580655
Genome map
AA seq 470 aa AA seqDB search
MMEELNLMKQAVQALMTGMPLALRDPHRPVWHLAPSVGLLNDPNGFIQHNGVYHLFYQWN
PLGCDHRNKCWGHWQSTDLLNWQHQPVALVPGACYDSHGCYSGSAVVADGKIMLAYTGNV
KYPDGSRTAYQCLALENAQGGYDKLGPVLPLPEGYSGHVRDPKVWRHQDNWYMVLGARDL
QDRGKVLLLRSADLRSWQLLGEIAGSQLNGMGDFGYMWECPDLFTLADAEVLICCPQGLA
AQDERYLNVYQAGYLTGKLDYRQAAFEHGEFHELDAGFEFYAPQTTLAEDGRRLLVGWMG
VPEQDEACHPTLQYGWIHTMTCPRELSLQNGKLYQQPARELQRLRGEGSQWQGIADNAPG
WPVDSAEVMLTPNGAFSADFGDAMTLSWDGALLRLTRNNLRNGQPEHRYWRGEVTHLQML
FDSSSVEIFINHGEGVMSSRYFPGPQPRLRLSGEAQLALEHWPLTPCMLE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagaactgaatttgatgaaacaggccgttcaggcgctgatgacgggtatgccg
ctggcgctgcgcgatcctcatcgcccggtatggcatctggcccccagcgtcggcctgctg
aacgaccccaacgggtttattcagcataatggggtttatcatctgttctatcagtggaac
ccgctgggctgcgatcaccgcaacaaatgctggggccattggcaatcgacggatctgctc
aactggcagcatcagccggtggcgctggtgcccggcgcttgttacgacagccacggctgt
tactcaggctcggcggtggtggcagacggcaaaatcatgctggcgtataccggcaacgta
aaataccccgacggttctcgcaccgcgtaccagtgcctggcgctggaaaatgcgcagggc
gggtatgacaagctcggcccggtgctgccgctgccggaaggctacagcggccacgtgcgc
gatcccaaggtttggcgccatcaagacaactggtacatggtgctcggtgcccgtgacctg
caggatcgcggtaaggtgctgttgctgcgctccgccgatctgcgcagttggcagctgttg
ggggagattgccggatcgcaactgaacggcatgggcgatttcggctatatgtgggaatgc
ccggacctgttcacgctggcggatgccgaagtgttgatttgttgcccgcaagggctggcg
gcgcaggacgaacgttatctcaacgtttaccaggcgggctatctgaccggcaagctggat
taccggcaggcggcctttgaacatggcgaattccacgagctggacgccgggttcgaattc
tatgcgccgcaaaccacgctggccgaagacggccgccgtctgctggtcggctggatgggc
gtaccggagcaggacgaagcctgtcacccgacgttgcaatacggctggatccataccatg
acctgcccgcgcgagctttctttgcagaacggcaagctttaccaacagccggcccgtgag
ttgcaacggttacgcggcgagggcagccaatggcagggaatcgcagataacgcgccgggc
tggccggtcgacagtgccgaagtgatgctgacgcccaacggcgcattcagcgccgacttt
ggcgatgcgatgacgttgagttgggacggcgccttgctgcgcctgacgcgcaacaacctg
cgcaacgggcaacctgaacaccgttactggcgcggtgaggtcacccatctgcaaatgctg
ttcgacagctccagcgtggagatttttatcaaccacggcgaaggggtcatgagctcacgc
tacttccctggcccgcagccgcgcctgcgtttgagcggagaggcgcagcttgcactggag
cactggccgctgacgccatgcatgctagaatga

DBGET integrated database retrieval system