KEGG   Serratia plymuthica 4Rx13: SOD_c43480Help
Entry
SOD_c43480        CDS       T02710                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:srl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SOD_c43480 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:srl03011]
    SOD_c43480 (rplV)
Ribosome [BR:srl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SOD_c43480 (rplV)
  Bacteria
    SOD_c43480 (rplV)
  Archaea
    SOD_c43480 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733
Motif
Other DBs
NCBI-ProteinID: AGO57291
Position
complement(4892909..4893241)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTDKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgccttgtt
gcagacctgatccgcggtaagaaagtgtcgcaagctctggaaactctgacctacaccgac
aagaaagctgccggtctggttaagaaagtgctggagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtcacgaaaatcttcgtagacgaaggccca
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system