KEGG   Serratia plymuthica 4Rx13: SOD_c45870Help
Entry
SOD_c45870        CDS       T02710                                 

Gene name
argH
Definition
(GenBank) argininosuccinate lyase ArgH
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00220  Arginine biosynthesis
srl00250  Alanine, aspartate and glutamate metabolism
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01130  Biosynthesis of antibiotics
srl01230  Biosynthesis of amino acids
Module
srl_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SOD_c45870 (argH)
   00220 Arginine biosynthesis
    SOD_c45870 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srl04147]
    SOD_c45870 (argH)
Enzymes [BR:srl01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     SOD_c45870 (argH)
Exosome [BR:srl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SOD_c45870 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2 ADSL_C Fur_reg_FbpA
Motif
Other DBs
NCBI-ProteinID: AGO57523
UniProt: S0AK48
Position
complement(5158925..5160298)
Genome map
AA seq 457 aa AA seqDB search
MALWGGRFSQAADQRFKQLNDSLRFDYRLAEQDIVGSVAWSKALVTVNVLTATEQQQLEQ
ALSVLLEEVQADPQAIVSSDAEDIHSWVEQKLIDKVGDLGKKLHTGRSRNDQVATDLKLW
CKQQIGELHQAIVQLQQALVETAEANQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDE
SRLQDTLKRLDVSPLGSGALAGTAYPIDREQLAGWLGFASATRNSLDSVSDRDHVLELLS
NASISMVHLSRFAEDLIFFNSGEAAFVDLSDRVTSGSSLMPQKKNPDALELIRGKCGRVQ
GALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWMDCLQMAALVLDGIQVKRPRCKEAA
EQGYANSTELADYLVAKGVPFREAHHIVGEAVVEAIQQGKALEALTLTELQKFSAVIGDD
VYPILALQSCLDKRSAKGGVSPQQVASAIAEAKQRLF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcactttggggcggacggttcagtcaggcggcagatcagcggttcaaacagttaaac
gactctctgcgctttgattatcgcctggcggaacaggacattgttggctctgtggcctgg
tcgaaagcgctggtcaccgtcaacgtgctgacggcaaccgagcagcaacagcttgagcag
gctttgagcgtgttgttggaagaggtgcaggccgacccgcaggcgattgtcagcagcgat
gcggaagatattcacagctgggtggagcagaagctgatcgataaagtcggcgatctgggc
aagaagctgcataccggccgtagccgtaacgatcaggtcgcgaccgatctgaaactgtgg
tgcaaacagcaaatcggcgaactgcatcaggccatagtgcaactgcagcaggcgctggtg
gaaactgccgaagccaatcaggatgcggtgatgccgggttatacccacctgcagcgcgcg
caaccggtcactttcgctcactggtgcctggcctatgtggaaatgctggcgcgcgatgaa
agccgcctgcaagatacgctcaagcgcctggacgtcagcccgctgggcagcggcgcgcta
gccggtaccgcttatccgatcgatcgtgaacagcttgccggttggttgggctttgcctcg
gccacccgcaatagcctggacagcgtttccgaccgcgaccacgtgctggagctgctgtcg
aatgcctccatcagcatggtgcatctgtcgcgctttgccgaagacctgatcttcttcaac
agcggcgaagcggcgtttgtcgacttgtctgaccgcgtaacctccggctcttcgttgatg
ccgcagaagaaaaacccggatgcgttggaactgatccgcggcaaatgcggccgtgtacag
ggcgcattgaccggcatgatgatgacgctgaaaggcttgccgctggcgtataacaaagac
atgcaggaagacaaggaagggctgttcgacgcactggatacctggatggattgcctgcag
atggcggcgctggtgctggacggcattcaggtgaaacgcccacgctgcaaagaggcggct
gagcagggttacgccaactcgaccgaactggcggactatctggtcgccaaaggcgtgccg
ttccgtgaggcgcaccatatcgtcggtgaagcggtggtagaagccatccaacagggcaag
gcgcttgaggcgctgacgctgaccgaattgcagaagttcagtgcggtgattggcgacgac
gtgtacccgatcctggcgctgcaatcttgcctggataagcgttcggccaagggcggcgtt
tctcctcagcaggtcgccagcgcgatcgccgaagcgaaacagcggttgttttaa

DBGET integrated database retrieval system