KEGG   Serratia plymuthica 4Rx13: SOD_c45900Help
Entry
SOD_c45900        CDS       T02710                                 

Gene name
argC
Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase ArgC
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00220  Arginine biosynthesis
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01130  Biosynthesis of antibiotics
srl01210  2-Oxocarboxylic acid metabolism
srl01230  Biosynthesis of amino acids
Module
srl_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SOD_c45900 (argC)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     SOD_c45900 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC NAD_binding_10 Epimerase GFO_IDH_MocA DapB_N
Motif
Other DBs
NCBI-ProteinID: AGO57526
UniProt: S0AL28
Position
complement(5162546..5163550)
Genome map
AA seq 334 aa AA seqDB search
MLNTLIVGASGYAGAELTAYLNRHPHMNITALAVSAQSADAGKLLSDLHPQLKGIVDLPL
QPLVDVAAAADGIDVVFLATAHEVSHDIAPLFLAAGCVVFDLSGAFRVKDAGFYTQYYGF
EHQHPELLDQAVYGLAEWQSEKIKQAQLIAVPGCYPTAAQLALKPLIDQQLLNLDQWPVI
NATSGVSGAGRKASVTTSFCEVSLQPYGIFNHRHHPEIVAHLGAPVIFTPHLGNFPRGIL
ETITCRLKAGVTAQDVAAAYHAAYDDKPLVRLYDKGVPALKAVVGLPFCDIGFAVQGEHL
IAVAAEDNLLKGAAAQAVQCLNIRFGFPETQSLL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatacgctgatcgttggtgccagcggttacgccggagcggagctcacggcttac
ctgaatcgtcacccacatatgaacataaccgcattagcggtttcagcgcaaagtgcagat
gcaggaaaattgctttctgatttgcatccccagttaaaaggcatcgtcgatctgccgtta
caaccgctggttgacgtggctgccgccgccgatggcatcgatgtggtgttcctggccacg
gcgcacgaggtcagccacgatatcgcgcctttgttcctggctgcgggctgtgtggtgttc
gatctgtccggtgcgttccgcgtaaaagacgccggtttctatacccagtactacggtttc
gagcatcagcatcctgagctgctggatcaggcggtatatggcctggcggagtggcagagc
gaaaaaatcaaacaggcgcaactgatcgccgtaccgggttgctacccgacggcggcgcag
ttggcgctgaaacccttgatcgatcaacagctgttgaatcttgaccaatggccggtcatc
aacgccaccagcggcgtcagcggcgcgggccgcaaagccagcgtgaccaccagcttctgt
gaagtaagcttgcagccgtacggcatcttcaaccaccgtcatcacccggaaatcgttgcg
catctgggtgcaccggtcatcttcacgccacatttgggtaacttcccgcgtggtattctc
gaaaccatcacctgccgtttgaaagccggcgttaccgcgcaggacgtggccgcagcctat
cacgccgcctatgacgacaaaccgctggtgcggctgtacgacaaaggcgtgccggcattg
aaagcggtggtgggcctgccgttctgcgatatcggctttgccgttcagggcgaacacctg
atcgccgtagcggcggaagacaacctgttgaaaggcgcggctgctcaggcggtgcaatgc
ctgaatatccgttttgggttcccggaaacccagtcattactttaa

DBGET integrated database retrieval system