KEGG   Serratia plymuthica 4Rx13: SOD_c45960Help
Entry
SOD_c45960        CDS       T02710                                 

Gene name
metL
Definition
(GenBank) bifunctional aspartokinase/homoserine dehydrogenase 2
  KO
K12525  bifunctional aspartokinase / homoserine dehydrogenase 2 [EC:2.7.2.4 1.1.1.3]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00260  Glycine, serine and threonine metabolism
srl00261  Monobactam biosynthesis
srl00270  Cysteine and methionine metabolism
srl00300  Lysine biosynthesis
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01120  Microbial metabolism in diverse environments
srl01130  Biosynthesis of antibiotics
srl01230  Biosynthesis of amino acids
Module
srl_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
srl_M00017  Methionine biosynthesis, apartate => homoserine => methionine
srl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SOD_c45960 (metL)
   00270 Cysteine and methionine metabolism
    SOD_c45960 (metL)
   00300 Lysine biosynthesis
    SOD_c45960 (metL)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SOD_c45960 (metL)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     SOD_c45960 (metL)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     SOD_c45960 (metL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Homoserine_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGO57532
UniProt: S0ALW4
Position
complement(5170558..5172993)
Genome map
AA seq 811 aa AA seqDB search
MNAIAVAGPVSGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPGDMMVVSAAGSTTNQLIN
WLKLSQSDRLSAHQVQQTLRRYHSELIGGLLPPETAEPLIAEFIQDLERLAVLLDDKIDD
VTYAEVVGHGEIWSARLMAAVLNKLDMQAAWLDARDFLRTERSAQPQVDEGRSYPLLQQL
LAQHPGKRLVVTGFISRNDAGETVLLGRNGSDYSATQVGALAGVERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGTGAKIVTSHDDVCLIELRVASQHDFKLAQKDLDLVLKRAQIKPLAVGIHPDRNL
VQLCYTSEVVNSVLRTLQDAGLPGELKLREGLALVALVGAGVCKNPLHSHRFYQQLKDQP
VEFIWQAEDGISLVAVLRQGPTALLIQGLHQSLFRAEKRIGLVLFGKGNIGARWLELFAR
EQKNISARSGFEFTLAGVVDSRRSLLDYDGLDASRALAFFEDEAQELDEESLFLWMRAHP
FDDLVVLDVTASENLAEQYLDFASYGFHVISANKLAGASCGDNYRQIRDAFAKTGRHWLY
NATVGAGLPVNHTVRDLRDSGDSILAISGIFSGTLSWLFLQFDGTVPFTELVDQAWQQGL
TEPDPRVDLSGQDVMRKLVILAREAGYDIEPNQVRVESLVPAGAEQGSVDQFFENGDALN
QQMLQRFEAASEMGLVLRHVARFDANGKARVGVEAVRPEHPLAALLPCDNVFAIESRWYR
DNPLVIRGPGAGRDVTAGAIQSDLNRLAQLL
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaattgcggtagcagggccggtgagcgggcgtcaactgcacaagtttggcggc
agcagcctggcggacgtgaagtgttatctgcgtgtggccgggatcatggccgaatacagc
cagccgggcgatatgatggtggtgtcggctgccggcagcaccaccaaccaactgattaac
tggctgaagctcagccagagcgatcgcctttctgcgcatcaggttcagcagacgctgcgc
cgttatcacagcgaattgatcggcggtttattgccgccggaaaccgccgaaccgctgatc
gccgaatttattcaggatctggagcgtctggcagttttgctggatgacaagattgacgac
gtgacttatgccgaggtcgtcggccacggcgaaatctggtcggcgcggctgatggctgcg
gtactgaacaagttggatatgcaggcggcctggctggatgcgcgcgattttctgcgtacg
gaacgctctgctcagccgcaggttgatgaaggccgttcttacccgctgctgcaacaattg
ctggctcagcacccaggcaaacgcctggtggtgaccggttttatttcacgcaacgacgcc
ggtgaaaccgtgctgttggggcgtaacggcagtgactattccgcgacccaggtcggcgct
ttggccggcgtggagcgcgtgactatctggagcgacgtggccggggtgtacagcgccgac
ccacgtaaagtgaaagatgcctgcctgctgccgctgctgcggttggatgaagccagcgaa
ctggcgcgtctggcggcaccggtgctgcatacccgcaccttgcagccggtttccggcagc
gatatcgatctccagctgcgatgcagttaccagccggaacagggttcaacgcgcatcgaa
cgcgtgctggcttccggcacgggcgcgaagattgtcaccagccatgatgacgtgtgcctg
attgagctgcgcgtcgccagccagcatgatttcaagctggcgcagaaagatctggatctg
gtgctgaagcgcgcgcagatcaaacccttggccgtcggcattcatccggaccgcaacctg
gttcagctgtgctacacctcggaagtggtgaacagcgtgctgcgtaccttgcaggatgcc
gggttgccgggggaactgaagctgcgcgaagggctggcgctggtggcgctggtgggggcg
ggggtttgcaaaaacccgctgcacagccatcgtttctaccaacagttgaaagaccagccg
gttgagtttatctggcaggcggaagacggcatcagcctggtggcggtactgcgtcagggg
ccgactgccttgctgattcagggcttgcaccagtcattgttccgcgctgaaaaacgcatc
ggtctggtgctgttcggcaaaggcaacattggcgcacgctggctggaactgtttgcccgc
gagcagaaaaatatttccgcccgcagcggttttgaattcactctggccggggtggtggac
agccgccgcagcctgctggattacgacgggctggacgccagccgcgcgctggcattcttc
gaggacgaagcgcaggagctggacgaagagtctctgttcctgtggatgcgtgcgcacccg
ttcgacgatctggtggtgcttgacgttaccgccagtgaaaatctggccgagcagtatctg
gacttcgccagctacggttttcacgtgattagcgccaacaagctggcgggcgcgtcgtgc
ggtgataactaccgccaaatccgcgatgccttcgccaaaaccggtcgtcactggctgtat
aacgccaccgtcggtgccggtctgccggtcaatcatacggtgcgcgatctgcgcgacagc
ggcgacagcattttggcgatcagcggtatcttctccggtacgctttcctggttgttcctg
cagttcgacggcacggtgccgttcaccgaactggtggatcaggcctggcagcaggggctg
acggaaccggatccgcgcgtcgatctctccggccaggacgtaatgcgcaagctggtcatt
ctggcgcgcgaagcgggctatgacatcgaaccgaatcaggtgcgggtagagtcgctggtg
cctgccggtgccgagcagggttctgtcgatcagttcttcgagaacggcgatgcgctgaac
caacagatgctgcagcgttttgaggctgccagcgaaatggggctggtgctgcggcacgtg
gcgcgcttcgatgccaacggcaaggcgcgtgtcggggtagaggcggtgcgtcctgagcac
ccgctggcggcgctgttgccgtgcgacaacgtgtttgctatcgaaagccgctggtaccgc
gataatccgttggtgatccgcgggccgggtgccggccgcgacgtcacggccggggcgatc
cagtcagaccttaaccgtttggcgcaactgctttaa

DBGET integrated database retrieval system