KEGG   Serratia plymuthica 4Rx13: SOD_c46020Help
Entry
SOD_c46020        CDS       T02710                                 

Gene name
ftsN
Definition
(GenBank) cell division protein FtsN
  KO
K03591  cell division protein FtsN
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srl03036]
    SOD_c46020 (ftsN)
Chromosome and associated proteins [BR:srl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    SOD_c46020 (ftsN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPOR TonB_N TFIIA Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: AGO57538
UniProt: S0AK64
Position
5178865..5179833
Genome map
AA seq 322 aa AA seqDB search
MAQKDYVGRGRTGARRKTPSRKKSSSPKVSKTVLALAVALLVIFIGGLYFITHNKPDDVP
LLPAHSNRPGNGLPPKPEERWRYIKELENRQIGVQTPTEPTAGGEVNSKTQLTTEQRQLL
EQMQADMQQRPTQLNEVPYNDPSQAAARGNSRQQQVQQQQIQQQVQQQVQQPQVTQPRNP
FNNGATTAPVQQHQQQAQPKPKPQPVTPPPVQVKQPEPKPQPKPEVKPETKPEVKQETAK
QETKPEQKQKWMVQCGSFRATDQAESVRARLAFEGIESRITAGGGWNRVVLGPYSSRATA
DKTLSRLKGAGMSSCIPLAVGG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaaaagactatgtaggccgtgggcgcacaggagcgcggcgcaaaacccccagc
cgtaaaaagagcagttctccgaaagtatccaaaaccgtgctggcgctagccgtagcactt
ctggtgatctttatcggtggcctctatttcattacgcacaataaaccggacgatgtaccg
ttgttgcctgcacacagcaaccgccctggcaatggcctgccgccgaagccggaagagcgc
tggcgctatatcaaagagctggagaaccgccagattggcgtgcagaccccgaccgagcca
acggccggcggcgaagtcaactccaagactcagttgaccactgaacaacgccaactgctg
gaacaaatgcaggcggatatgcaacagcgcccaacgcaactgaatgaagtgccgtataac
gacccttctcaagccgcggcgcgcggcaacagccgccagcagcaggtgcagcaacaacaa
atacagcagcaagttcagcaacaggtgcagcaaccacaggttacccagccgcgtaatccg
tttaacaacggtgcaaccacggcgccggtgcaacagcaccagcagcaagctcaacccaaa
cccaagccgcagccggtaacgccgccgccggtccaggttaagcagcctgagcctaaaccg
cagccaaaacctgaggtaaaaccggaaaccaagccggaagtgaaacaggaaacggccaag
caggaaaccaagcctgagcagaaacagaagtggatggtgcaatgcggttcgttccgtgcc
accgatcaggcggaatccgtccgtgcgcgcctggcgtttgaaggtatcgaaagccgcatc
accgccggcggcggttggaatcgcgtggtgctcggcccctacagcagccgcgcaacagcg
gacaaaaccctatcgcgtctgaagggcgctggcatgtcaagttgcattcccctcgccgtt
gggggttga

DBGET integrated database retrieval system