KEGG   Serratia plymuthica 4Rx13: SOD_c46030Help
Entry
SOD_c46030        CDS       T02710                                 

Gene name
hslV
Definition
(GenBank) ATP-dependent protease subunit HslV
  KO
K01419  ATP-dependent HslUV protease, peptidase subunit HslV [EC:3.4.25.2]
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:srl01002]
    SOD_c46030 (hslV)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.2  HslU---HslV peptidase
     SOD_c46030 (hslV)
Peptidases [BR:srl01002]
 Threonine Peptidases
  Family T1: proteasome family
   SOD_c46030 (hslV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proteasome PspC
Motif
Other DBs
NCBI-ProteinID: AGO57539
UniProt: S0ANI1
Position
5179936..5180466
Genome map
AA seq 176 aa AA seqDB search
MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVKKVRRLYNDKVIAGFAGGTADAFTLFEL
FERKLEMHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADEHSSLIITGNGDVIQPENDL
IAIGSGGPYAQAAARAMLENTELSAREIVDKSLNIAGDICIYTNHFHTIEELPSKA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacaattgtaagcgtacgccgcaacggccaggtagtgatcggtggcgatggccag
gccaccttgggcaatacggtaatgaagggcaacgtcaagaaagtgcgtcgcctgtataac
gacaaagtgattgccggtttcgccggtggcactgcggatgccttcacgctgtttgagctg
ttcgagcgcaagctggaaatgcaccagggccatttggttaaagcggccgttgagttggct
aaagactggcgtaccgaccgcatgctgcgcaagcttgaagcgctgctggccgtggcggat
gaacactcttcgctgatcatcaccggcaacggtgacgtgatccagcctgaaaatgatttg
attgcgatcggttccggcggcccatacgcccaggctgccgctcgtgcgatgttggaaaat
accgagctgagcgcccgcgaaatcgttgataaatccctcaacatcgccggtgacatctgt
atttacaccaaccatttccacaccatcgaagaattgccttccaaagcgtaa

DBGET integrated database retrieval system