KEGG   Serratia plymuthica 4Rx13: SOD_c46080Help
Entry
SOD_c46080        CDS       T02710                                 

Gene name
glpF
Definition
(GenBank) glycerol uptake facilitator protein GlpF
  KO
K02440  glycerol uptake facilitator protein
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srl02000]
    SOD_c46080 (glpF)
Transporters [BR:srl02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    SOD_c46080 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AGO57544
UniProt: S0ANI8
Position
5184222..5185067
Genome map
AA seq 281 aa AA seqDB search
MSQTTSPTLKGQCIAEFLGTGLLIFFGVGCVAALKLAGASFGQWEISIIWGLGVAMAIYL
TAAISGAHLNPAVTIALWLFACFDGRKVLPYIVAQIAGAFCAAALVYGLYYNLFFDFEAA
NHMVRGSDESLALAGIFSTYPNAHISVGQAFLVETVITAILMCLILALTDDGNGIPRGPL
APLLIGILIAVIGASMGPLTGFALNPARDFGPKLFAYLAGWGKVAFTGARDIPYFLVPIF
GPILGAGLGAFGYRALIGRHLPCDVCVEEEEPATKAQQRKA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaccaccagtccgaccctaaaaggccagtgtatcgccgagttcctcggcaca
ggtttgttgatcttttttggcgtaggctgcgttgccgcactgaaactggcgggcgccagc
ttcggccagtgggaaatcagtatcatttggggcctgggcgttgccatggccatctatctg
actgctgccatctccggtgcgcaccttaacccggccgtcactatcgcgctgtggttgttc
gcctgctttgacggacgcaaagtactcccttacattgtcgcgcagatcgccggagccttc
tgcgcagcagccctggtctacgggttgtattacaacctgttcttcgatttcgaagcggcc
aaccatatggtccgcggcagcgacgagagccttgctctggccggtatcttctccacttat
cctaacgcgcacatctccgtcggccaggccttcctggtggaaacggtgattaccgcgatt
ctgatgtgcctgattctggcgctgaccgacgacggcaacggtattccacgtggcccgctg
gcaccgctgctgatcggtattctgattgccgttatcggcgcctccatgggcccattgacc
ggctttgctttgaacccggcgcgtgatttcggcccgaaactgttcgcttatctggcaggt
tggggcaaagtggccttcaccggggcacgtgatatcccgtacttcctggtgccaatcttt
ggccctatcctcggtgccggtctgggtgccttcggctaccgtgctctgattggccgccat
ctgccgtgcgatgtttgcgtagaggaagaagaacccgctaccaaggcccaacagcgcaaa
gcgtga

DBGET integrated database retrieval system