KEGG   Serratia plymuthica 4Rx13: SOD_c46150Help
Entry
SOD_c46150        CDS       T02710                                 

Gene name
yiiQ
Definition
(GenBank) YiiQ
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1454
Motif
Other DBs
NCBI-ProteinID: AGO57551
UniProt: S0AL58
Position
5191280..5191870
Genome map
AA seq 196 aa AA seqDB search
MLRKFIAIACLLLGISSAWADPPDAAASASPTAPYLLAGAPTFDLTVVIFREKYNRDNPT
LPIGEFRAIATAEDDSPLLTRAASKLNENLYASTALEKGTGKIKTLQITHLPLQQSSEEK
AARSVAVSYMAALMRQFEPALTVEQSLAKVTSLLEKGKGSRFYQQQVGAIRYVVSDNGDK
GVTFAVEPVKLALSEP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaaaattcatcgccatcgcctgcctgttgctgggtatcagcagtgcctgggcc
gatccaccggatgccgccgccagtgcgtcgcccaccgcaccttacctgctggccggcgcg
ccgacgtttgatctgacggtggtaatattccgcgaaaaatacaatcgcgataatccaacg
ctgccgatcggcgaatttcgcgccattgcaaccgcagaagacgactcgccattgctgacg
cgtgccgccagcaagctgaatgaaaacctctatgcctccaccgcgctggaaaaaggcacc
ggtaaaatcaaaacgctgcagatcactcacctgccgctgcaacaaagcagcgaagagaaa
gccgctcgcagcgttgccgtcagctacatggccgcgctgatgcgccaatttgaacccgcg
ttgacggtggagcaaagtctggcgaaagtgaccagcctgttggaaaagggcaaaggctca
cgcttctaccaacagcaggtcggcgcgatccgctacgtggtatcggacaacggcgataaa
ggggtaactttcgctgttgaaccggttaagctggcgttatccgagccttaa

DBGET integrated database retrieval system