KEGG   Serratia plymuthica 4Rx13: SOD_c46160Help
Entry
SOD_c46160        CDS       T02710                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00010  Glycolysis / Gluconeogenesis
srl00051  Fructose and mannose metabolism
srl00562  Inositol phosphate metabolism
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01120  Microbial metabolism in diverse environments
srl01130  Biosynthesis of antibiotics
srl01200  Carbon metabolism
srl01230  Biosynthesis of amino acids
Module
srl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
srl_M00002  Glycolysis, core module involving three-carbon compounds
srl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOD_c46160 (tpiA)
   00051 Fructose and mannose metabolism
    SOD_c46160 (tpiA)
   00562 Inositol phosphate metabolism
    SOD_c46160 (tpiA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srl04147]
    SOD_c46160 (tpiA)
Enzymes [BR:srl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SOD_c46160 (tpiA)
Exosome [BR:srl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SOD_c46160 (tpiA)
  Exosomal proteins of bladder cancer cells
   SOD_c46160 (tpiA)
  Exosomal proteins of melanoma cells
   SOD_c46160 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AGO57552
UniProt: S0ALY8
Position
5191998..5192765
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAALRNELSSVDGCGVAIAPPVMYLDQAKHALAGSRIA
LGAQNVDVNLSGAFTGEVSADMLKDVGAQYIIIGHSERRTYHKETDAAIAEKFAVLKAAG
LIPVLCIGETDAENEAGKTEEVCARQIDAVLKTQGAEAFKGTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAEVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattagttatgggtaactggaagcttaacggcagcactcacatggttaac
gaactcattgccgctctgcgcaatgaactgagcagcgttgacggttgtggcgtggctatc
gcaccgccggtgatgtacctggatcaggccaagcacgctctggccggcagccgcattgct
ctgggcgctcaaaatgtagacgtgaacctgtccggtgcattcaccggcgaagtttccgct
gacatgctgaaagatgtaggcgcgcaatacatcatcatcggccactccgaacgtcgcact
taccacaaagaaaccgacgctgcgatcgccgaaaaatttgccgtgctgaaagcggccggt
ctgatcccggtgctgtgcatcggtgaaaccgatgcagaaaacgaagcgggtaaaaccgaa
gaagtttgcgcacgccagatcgacgccgtgctgaaaacccagggcgctgaagcgttcaaa
ggtaccgttatcgcttatgagccagtttgggccatcggtaccggcaagtcagctacgcct
gcgcaagcacaggcagtacacaaatttatccgcgatcacatcgccaagcaggacgcagcc
gtagctgcagaagtgatcatccagtacggcggttctgtaaacgataagaatgctgccgag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcatcactgaaagctgac
gctttcgccgtgatcgtcaaagccgctgcagccgctaaaaaagcctga

DBGET integrated database retrieval system