KEGG   Serratia plymuthica 4Rx13: SOD_c46170Help
Entry
SOD_c46170        CDS       T02710                                 

Gene name
sbp
Definition
(GenBank) sulfate-binding protein Sbp
  KO
K02048  sulfate transport system substrate-binding protein
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00920  Sulfur metabolism
srl02010  ABC transporters
Module
srl_M00185  Sulfate transport system
srl_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SOD_c46170 (sbp)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SOD_c46170 (sbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srl02000]
    SOD_c46170 (sbp)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    SOD_c46170 (sbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1 SBP_bac_6 SBP_bac_8 PBP_like DUF3105
Motif
Other DBs
NCBI-ProteinID: AGO57553
UniProt: S0AK79
Position
complement(5192832..5193821)
Genome map
AA seq 329 aa AA seqDB search
MRKWGVGLTIMLLASGAMAKDIQLLNVSYDPTREFYQEYNTAFGKYWQQQTGDKVTVRQS
HGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKDWIKRLPDNSAPYTSTIVFLV
RKGNPKQIHDWADLIKPGVSVITPNPKTSGGARWNYLAAWGYALHHNNNDKAKAQEFVKN
LYKNVEVLDSGARGSTNTFVERGIGDVLIAWENEALLAEKELGKDKFEIITPSESILAEP
TVSVVDKVVDKRGTRDVATAYLKYLYTPEGQTIAAKNYYRPRDAAVAAKFADQFPKLKLF
TVDDTFGGWTEAQKVHFATGGVFDEISKR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaatggggtgtaggtctgacaataatgctgctggcgtccggtgccatggcgaaa
gatatccaactgctgaacgtttcgtacgacccgacgcgtgagttctatcaggaatacaac
accgcattcggtaagtactggcagcagcaaaccggcgataaagtgacggtgcgtcagtcg
catggcggttccggcaagcaggccacctcggtgattaacggtattgaggccgacgtggtt
acactggcgctggcctatgatgtggatgccatcgccgagcgtgggcgcatcgacaaagac
tggattaaacgtctgccggacaactccgcgccttatacctcgaccatcgtgttcctggtg
cgcaaaggtaacccaaaacaaattcacgactgggccgatttgattaaaccgggcgtgtcg
gtgattacaccgaatccgaaaacctccggcggtgctcgttggaactatctggctgcctgg
ggttacgcgctgcaccacaacaataacgataaagccaaggcgcaggagttcgtgaaaaac
ctgtataaaaacgttgaagtgctggattccggtgcgcgtggctcgaccaataccttcgtt
gaacgcggtatcggcgacgtgctgattgcctgggaaaacgaagcgttgttggcggaaaaa
gagctgggcaaagacaagtttgaaattatcaccccgagcgaatcgattctggcggagccg
accgtctcagtggtagataaagtggtcgataagcgcggcactcgcgatgtggcaacggct
tacctgaagtatctgtatacgccggaagggcagaccatcgcggcgaaaaactactatcgc
ccgcgtgatgcggcggtggcggccaagtttgccgaccagttcccgaaactgaagctgttc
accgtggatgataccttcggcggctggaccgaagcgcagaaggtgcactttgccaccggc
ggcgtgttcgacgagatcagcaagcgctga

DBGET integrated database retrieval system