KEGG   Serratia plymuthica 4Rx13: SOD_c46250Help
Entry
SOD_c46250        CDS       T02710                                 

Gene name
ydcL
Definition
(GenBank) putative lipoprotein YdcL
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3313
Motif
Other DBs
NCBI-ProteinID: AGO57561
UniProt: S0AL67
Position
5200410..5201081
Genome map
AA seq 223 aa AA seqDB search
MKKKRLSVAMAVLATGLLLAGCSSKVANKQQYSGFLSDYSKLQETESATGHKTLRWIDPT
FKESNYRGVYFSPVTYYPAAKPTARVNQDTLNKIKDYANQRINAALSERMTVLQSPSGSR
VLLAKVAITAVSAENEDLKFYEVTPVTAVIASTMAASGHRTQNTTLFLEAQLIDQDTGKT
VMEVVRKGYGKTVSNDSAPVTANEVKAAIDSMVTDIVKFPKQG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaacgcttgagcgttgccatggcggtgctggcaacaggcctgttgttggcg
ggctgttcgtctaaagtagcaaataagcagcagtattcaggttttctgagcgattacagc
aagctgcaggaaaccgaatcggccaccggccataaaacgctgcgttggatcgatcctacc
tttaaagaatccaattaccggggcgtctatttttctcctgtgacctattacccggcggcc
aaaccgacggcacgcgtcaaccaggatacgctgaacaaaatcaaagactacgccaatcag
agaatcaacgccgcactgagcgagcgaatgaccgtgctgcaaagcccgtcaggatcgcgc
gtgctgctcgccaaagtggcgatcaccgccgtgtcggctgaaaatgaagatctgaagttc
tatgaagtgaccccggttaccgcagtgatcgccagtaccatggccgccagcgggcaccgc
acgcaaaacaccacgctgttcctcgaagcgcaactgatcgatcaggataccggcaaaacg
gtgatggaagtggtgcgtaaaggctatggcaagaccgtcagcaatgactccgcgccggtg
acggcgaacgaggtcaaagcggcgatcgatagcatggttaccgatatcgtgaaattcccg
aaacagggttaa

DBGET integrated database retrieval system