KEGG   Serratia plymuthica 4Rx13: SOD_c46270Help
Entry
SOD_c46270        CDS       T02710                                 

Gene name
gpsA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase [NAD(p)+] GpsA
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00564  Glycerophospholipid metabolism
srl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SOD_c46270 (gpsA)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     SOD_c46270 (gpsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N ApbA F420_oxidored NAD_binding_2 TrkA_N UDPG_MGDP_dh_N 3HCDH_N GIDA Rossmann-like ApbA_C Pyr_redox_2 NAD_binding_8 UIM
Motif
Other DBs
NCBI-ProteinID: AGO57563
UniProt: S0AK91
Position
complement(5202140..5203159)
Genome map
AA seq 339 aa AA seqDB search
MNTVNASMTVIGAGSYGTALAITLARNGHPVVLWGHNPEQIQKLQRDRCNQAFLPDVAFP
DTLLLEADLARALAASRDVLVVVPSHVFGDVLRQLKPHLRPDARIVWATKGLEAETGRLL
QDVAREALGDDIPLAVVSGPTFAKELAAGLPTAIALASTDTQFAEDLQQLLHCGKSFRVY
SNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRGLAEMSRLGSALGADPSTF
MGMAGLGDLVLTCTDNQSRNRRFGIMLGQGKGVQEAQDSIGQVVEGYRNTKEVLALAQRH
GVEMPITEQIYQVLYCHKNAREAALSLLGRTRKDEKHSI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgtcaatgcttcaatgaccgttatcggtgccggctcgtacggcaccgcatta
gccattacgctggcgcgtaacggccaccccgtggtgctgtgggggcataacccagagcaa
attcaaaaattgcagcgtgaccgctgcaatcaggcgtttctccccgacgttgccttcccc
gacacgctgctgttagaagccgatctggcacgtgcgctggctgccagtcgcgatgtgctg
gtggtggtgccaagccatgtgttcggtgacgtattgcgccagctaaagccgcatctgcgc
ccggatgcccgcattgtgtgggcgaccaaagggctggaagcggagaccggccggttgttg
caggacgtagcgcgcgaagcgctgggcgatgatatcccgctggcggtggtctcagggcca
acgttcgccaaagagctggccgccgggctgccgaccgcgattgcgctggcttccaccgat
actcagtttgccgaagatctgcaacagctgctgcattgcggtaaaagcttccgcgtttac
agcaaccccgattttatcggcgtgcagttgggtggtgcggtgaagaacgtgattgccatc
ggcgccgggatgtcagacggtatcggctttggcgccaatgcgcgtactgcattgattacc
cgtggcctggcggaaatgagccgcctcggctcggcgttgggtgccgatccctcgaccttc
atgggcatggccggtttgggtgatctggtgctgacctgcaccgataatcaatcgcgcaac
cgccgtttcggtattatgctggggcagggaaaaggcgtgcaagaggcgcaagacagtatc
ggtcaggtggttgaaggctatcgcaataccaaagaggtgttggcgctggcgcagcgacac
ggtgtggaaatgccgattaccgaacagatttaccaggtgttgtactgccataaaaatgcc
cgggaagctgcgttgagcctgttagggcgcaccagaaaagacgaaaagcacagcatctga

DBGET integrated database retrieval system