KEGG   Serratia plymuthica 4Rx13: SOD_c46280Help
Entry
SOD_c46280        CDS       T02710                                 

Gene name
secB
Definition
(GenBank) protein-export protein SecB
  KO
K03071  preprotein translocase subunit SecB
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl02024  Quorum sensing
srl03060  Protein export
srl03070  Bacterial secretion system
Module
srl_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:srl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SOD_c46280 (secB)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SOD_c46280 (secB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SOD_c46280 (secB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:srl03110]
    SOD_c46280 (secB)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:srl02044]
    SOD_c46280 (secB)
Chaperones and folding catalysts [BR:srl03110]
 Other chaperones and cochaperones
  SecB
   SOD_c46280 (secB)
Secretion system [BR:srl02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   SOD_c46280 (secB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecB
Motif
Other DBs
NCBI-ProteinID: AGO57564
UniProt: S0ANL2
Position
complement(5203159..5203629)
Genome map
AA seq 156 aa AA seqDB search
MSEQNSTEMAFQIQRIYTKDISFEAPNAPQVFQQEWQPEVKLDLDTASSQLADEVYEVVL
RVTVTASLGEETAFLCEVQQAGIFSVAGIDGTQLAHCLGAYCPNILFPYARECITSLVSR
GTFPQLNLAPVNFDALFMNYLQQQAEGEGAAPHQDA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaaaacagcacagagatggctttccagattcagcgcatttacaccaaggat
atctccttcgaagcgccaaacgctccgcaggttttccagcaggaatggcagccagaagtt
aaactggatctagataccgcttccagccagttggctgacgaagtgtatgaagttgtactg
cgcgtaaccgtgactgcgtctctgggcgaagaaactgcgttcctgtgtgaagtgcagcag
gcgggcatcttctccgttgcaggcatcgacggcacgcagctggcgcattgcctgggtgca
tactgcccgaacattctgttcccgtatgcgcgtgagtgcatcaccagcctggtttctcgc
ggcacattcccgcaactgaacctggcaccggttaacttcgacgcgctgttcatgaactat
ctgcaacagcaggcggaaggcgaaggtgccgcaccacatcaggatgcctga

DBGET integrated database retrieval system