KEGG   Serratia plymuthica 4Rx13: SOD_c46320Help
Entry
SOD_c46320        CDS       T02710                                 

Gene name
envC
Definition
(GenBank) murein hydrolase activator EnvC
  KO
K22719  murein hydrolase activator
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    SOD_c46320 (envC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 Reo_sigmaC FliJ
Motif
Other DBs
NCBI-ProteinID: AGO57568
UniProt: S0AK96
Position
5206355..5207587
Genome map
AA seq 410 aa AA seqDB search
MCASVFCAGVLLLPLAGQAAEDNKSQLKDIQQSIAEKEKAVKQQQQQRSSLQDQLKQQEK
TIAQASRLLRDTQGTLSQLGKDISGLNASIAKLQKQQSTQQEILAKQLDAAFRQGQHSAV
QLILSGEESQRSERILAYFSYLNEARQQTIEELKQTRVELAKQKTTLVAKQGQQKSLLGE
QQTQQQKLEQARGARKQTLTALEASLEKDQQRLVELRQNETRMRDKIARAEREARARAER
EAREAAKVREQMRAKEQQAKKTGTSYKPSEADRSLIARTGGLGRPSGQAMWPVRGRTLHS
FGEQLQGELRWKGMVISAAEGSEVKAIADGRVLLADWLQGYGLVVVVEHGKGDMSLYGYN
QSALVNVGAQVRAGQPIALVGTSGGQGTPSLYFEIRRQGQAVNPLPWLGR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccagcgtattttgcgctggcgtcttgctgttgccgttagccggacaggcggcg
gaagacaacaaatcccagctcaaagacatccagcaaagcatcgccgaaaaagagaaggcg
gttaaacagcagcaacagcaacgcagctcattgcaggatcagcttaaacagcaggaaaaa
accatcgcgcaggccagccgcctgctgcgtgacacccagggcacgctaagccaactgggg
aaagacatttccggcctgaacgcctccatcgccaagctgcaaaagcagcagtctactcag
caagagatcctcgccaaacagctcgacgccgctttccggcaggggcaacacagtgcagta
caactgatcctcagcggtgaggagagccagcgcagcgagcgtattctggcttacttcagc
tatctgaacgaggcgcgtcagcaaactatcgaagaactgaagcaaacccgtgtcgagctg
gcaaaacaaaaaaccacgctggtggccaaacagggccagcaaaaatcgctgttgggcgaa
cagcaaacgcaacaacagaagctggagcaggcacgtggcgcacgtaagcaaacgctgacc
gcactggaagcctcgctggaaaaagatcagcagcggctggtggaactgcgtcaaaacgaa
acccgcatgcgcgataaaattgcccgagctgaacgcgaagcccgcgcccgtgccgaacgt
gaagcgcgtgaagccgccaaggtgcgcgagcaaatgcgcgccaaagaacagcaggcgaag
aaaaccggcaccagttacaaacctagcgaagccgaccgctcgctgattgcccggaccggc
ggccttggcagaccgagcggacaagcgatgtggccggttcgtggccgcaccttgcacagt
tttggtgaacaattgcagggcgagttacgctggaaaggcatggtgatctcggccgccgaa
ggcagcgaagtgaaagccattgccgacggccgcgtattgctggccgactggctgcaaggc
tatggtctggtcgtcgtagtcgagcacggtaagggcgacatgagcctgtatggctataac
cagagcgcgttggtcaacgtcggggcgcaggtccgcgccgggcagccgatagccttggta
ggcaccagcggaggccagggaacgccgtcgctttatttcgaaatccgtcgtcaaggtcag
gcggttaacccactaccgtggttgggaagatag

DBGET integrated database retrieval system