KEGG   Serratia plymuthica 4Rx13: SOD_c46330Help
Entry
SOD_c46330        CDS       T02710                                 

Gene name
yibQ
Definition
(GenBank) YibQ
  KO
K09798  uncharacterized protein
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SOD_c46330 (yibQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_2
Motif
Other DBs
NCBI-ProteinID: AGO57569
UniProt: S0ANL7
Position
5207590..5208555
Genome map
AA seq 321 aa AA seqDB search
MRYIKTRTVVLIGCLLQVCAAQAGKLSIVIDDVGYRPHEEGAVLQMPTAISVAVLPNAPH
ARLMATRAHSQGREVLIHMPMAPLSKQPLERDTLQPSMSSEEIQRIIRNAVNNVPYAVGM
NNHMGSAMTSSLPGMQKVMQALESYRLYFLDSMTIGNSQATRAAAGTGVKVIKRKVFLDD
TANEADIRRQFNRAVDLARRNGSAIAIGHPRPATVKVLQQMLPTLPADIVLVKPSSLLNE
PQSNSGGGSYVPPPVKPQKPQPKNPFTGGIKQCKVKLPKEKVNAGKAISVIGESVTQSPA
AEFIKRQWHRWVDSAPDKPKA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctatatcaaaacccgtactgtcgtattgattggctgtctgttgcaggtttgcgcc
gcgcaggcggggaagttgtccatcgttatcgatgacgtgggttatcggccgcacgaggaa
ggcgccgtgctgcaaatgccgacggcgatctccgttgccgtgctgcccaatgcccctcac
gcccgtctaatggccacccgcgcccacagccagggccgcgaagtgttgattcacatgcca
atggccccgctcagcaaacagccgttggagcgcgatacgctgcagccgtccatgagcagc
gaagagatccagcgcatcatccgcaatgcggtgaataacgtgccctacgcggtcgggatg
aacaaccacatgggcagcgccatgacctccagcctgccgggcatgcagaaagtcatgcag
gcgctcgaaagttaccgcctgtactttctcgatagcatgaccattggcaatagccaggcc
acccgtgccgctgcagggaccggggtgaaggtcatcaagcgtaaagtgtttctggacgat
accgccaacgaggccgatattcgccgccagtttaaccgtgcggtcgatctggcacgccgc
aacggttccgccatcgcgattggccatccacgtccggcgacggtaaaggtgctgcagcaa
atgctgccgacgttgccggccgatatcgtgctggtaaaacccagttcgctgctgaatgaa
ccgcagagtaacagcggcggcggcagttacgttccaccgccggtcaagccgcagaaaccg
cagccgaagaacccgttcaccggcggtatcaagcagtgcaaggtcaagttgccgaaggaa
aaagtcaacgcaggcaaggcgataagcgtgatcggcgaaagcgtgacacagtcgccggcg
gcagagtttatcaagcgccagtggcatcgctgggtcgactcagcgccagacaaaccgaaa
gcataa

DBGET integrated database retrieval system