KEGG   Serratia plymuthica 4Rx13: SOD_c46490Help
Entry
SOD_c46490        CDS       T02710                                 

Gene name
kdtX
Definition
(GenBank) lipopolysaccharide core biosynthesis glycosyltransferase KdtX
  KO
K12984  (heptosyl)LPS beta-1,4-glucosyltransferase [EC:2.4.1.-]
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:srl01003]
    SOD_c46490 (kdtX)
   01005 Lipopolysaccharide biosynthesis proteins [BR:srl01005]
    SOD_c46490 (kdtX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srl02000]
    SOD_c46490 (kdtX)
Enzymes [BR:srl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     SOD_c46490 (kdtX)
Glycosyltransferases [BR:srl01003]
 Polysaccharide
  Bacterial polysaccharide
   SOD_c46490 (kdtX)
Lipopolysaccharide biosynthesis proteins [BR:srl01005]
 Core region
  SOD_c46490 (kdtX)
Transporters [BR:srl02000]
 Other Transporters
  Others
   SOD_c46490 (kdtX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_4 Glyco_tranf_2_3 Glyco_tranf_2_2
Motif
Other DBs
NCBI-ProteinID: AGO57585
UniProt: S0AP45
Position
5225472..5226245
Genome map
AA seq 257 aa AA seqDB search
MSDRKSLSVVIIAKNEAGLLPDCLNSVAWADEVVILDSGSQDDSIAIAENLGAKVFVHTD
WQGFGKQRQLAQSYASHDYILMIDADERVTPELRQSIEQTLAAPDDNQVYSCARRNLFLG
RFMRHSGWYPDRVNRLYANRRYRYNDDLVHESLNIGAAKVVPLSGDLLHLTCRDFFAFQR
KQLRYAEEWANQRHQAGKRCGYSSILTHTLGAFCKTWLLRAGFLDGKQGLLLAVVNAQYT
FNKYAALWALGRNSSEK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccgcaaaagcctgtcggtggtgatcatcgccaagaacgaagccgggctgctg
ccggattgcctgaactctgtggcctgggcggacgaagtggtcattctcgattcgggcagc
caggatgacagcatcgccattgccgaaaacctcggtgccaaagtgttcgtccataccgac
tggcagggcttcggcaaacagcgccaattggctcaaagctacgccagccacgactatatt
ctgatgatcgacgctgacgagcgcgtcacccccgaactgcgccagtcgattgaacagacc
ttggccgcgcctgacgacaatcaggtctacagttgtgcgcgccgcaacctgttccttgga
cgttttatgcgtcacagcgggtggtatccggatcgcgtcaaccggctgtacgccaaccga
cgctatcgctataacgacgatctggtgcatgaatcgctcaatatcggcgccgcgaaagtg
gtacccctcagcggcgatctgctacacctgacctgtcgcgactttttcgctttccagcgc
aagcagttgcgttatgccgaagaatgggccaatcagcgtcatcaggccggcaagcgctgc
ggttactcctccatactgactcatactctcggtgccttctgcaaaacctggctgctgcgc
gccggcttcctcgacggtaaacaggggttgctgttagccgtggtcaacgcgcaatatacc
ttcaataaatatgccgcattgtgggcattgggccgcaactcttcagagaagtga

DBGET integrated database retrieval system