KEGG   Serratia plymuthica 4Rx13: SOD_c46530Help
Entry
SOD_c46530        CDS       T02710                                 

Gene name
rpmB
Definition
(GenBank) 50S ribosomal protein L28
  KO
K02902  large subunit ribosomal protein L28
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl03010  Ribosome
Module
srl_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:srl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SOD_c46530 (rpmB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:srl03011]
    SOD_c46530 (rpmB)
Ribosome [BR:srl03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SOD_c46530 (rpmB)
  Bacteria
    SOD_c46530 (rpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L28
Motif
Other DBs
NCBI-ProteinID: AGO57589
UniProt: S0ANQ6
Position
complement(5227803..5228039)
Genome map
AA seq 78 aa AA seqDB search
MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVEAEKRFVTLRVSAKGMRVID
KKGIETVLADLRTRGEKY
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgagtctgccaagttactggcaagcgcccggtgagcggtaacaaccgttcccac
gcaatgaacgcgaccaaacgccgttttctgccgaacctgcactcacaccgtttttgggtt
gaggctgagaagcgctttgtaacgctgcgtgtatctgctaaaggtatgcgtgttatcgat
aagaagggtattgagacggtcttggccgatctgcgtacccgtggtgagaagtattaa

DBGET integrated database retrieval system