KEGG   Serratia plymuthica 4Rx13: SOD_c46550Help
Entry
SOD_c46550        CDS       T02710                                 

Gene name
coaBC
Definition
(GenBank) coenzyme A biosynthesis bifunctional protein CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00770  Pantothenate and CoA biosynthesis
srl01100  Metabolic pathways
Module
srl_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SOD_c46550 (coaBC)
Enzymes [BR:srl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SOD_c46550 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     SOD_c46550 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AGO57591
UniProt: S0ALB6
Position
5229171..5230385
Genome map
AA seq 404 aa AA seqDB search
MTGLSGKHIVLGISGGIAAYKCPELVRRLRDRGAEVRVVMTGAAKAFITPLTLQAVSGYP
VSDDLLDPAAEAAMGHIELGKWADLVILAPATADLLARVAAGMANDLLTTLCLATDAPIA
AAPAMNQQMYRATATQANLQTLQARGILLWGPDSGSQACGDIGPGRMLDPLNIVDLANGY
FSASQDLQHLKIMITAGPTREALDPVRFISNHSSGKMGFSIAQAAAARGAQVTLIAGPVN
QPTPPSVTRVDVISALEMEHAVQQRAAQQDIFISCAAVADYRAGQIAGEKIKKQGDEIIL
KMVKNPDIVAGVAAMTKNRPFVVGFAAETQNVEEYARQKLARKKLDLICANDVSLAEHGF
NSDTNALHLFWQNGEKRLALSDKALLGQRLIDEIVSRYDEKNRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacgggactttccggcaaacatattgtgcttggcatcagtggcggtatcgctgcgtac
aaatgcccagaactggtgcgccgcctgcgtgacagaggcgcggaagtgcgtgtggtaatg
accggcgcggcgaaagcgttcatcacgccgctgacgctgcaggcggtttccggctatccg
gtctccgacgatctgctggatcccgcagccgaagccgcaatgggtcacatagagctcgga
aaatgggcggatttagtgattcttgccccagctaccgccgatctgctggcacgcgtcgct
gccggcatggccaacgatctgctgacgaccctttgcctggcgaccgacgcaccgatagcc
gcagcgcctgccatgaaccaacagatgtatcgcgccaccgccacccaagccaatctgcaa
acgctgcaggcacgcggcatattgctgtggggcccggacagcggcagccaggcttgtggc
gatattgggccgggccgcatgctcgatcccttgaacatcgtcgatctggcgaacggttat
ttctccgcttcacaagatttgcaacatttaaagattatgatcaccgccggcccaacgcgt
gaagcgctggacccggtgcgtttcatcagcaatcacagttccggtaaaatgggcttctct
atcgcccaagccgccgccgcacgcggtgcgcaggtcaccttgattgccggtccggtcaac
cagccgacgccgccgtcggtaacccgggtagacgtcatcagtgcgctggaaatggaacac
gcagtacagcagcgcgccgcccagcaggacattttcatttcctgtgccgccgtagccgat
taccgtgccgggcagatcgccggtgaaaaaataaaaaaacagggtgatgaaatcatcctc
aaaatggtaaaaaaccccgacatcgttgccggcgtcgccgcaatgactaaaaatcgcccc
tttgtcgtggggtttgccgccgaaacccagaatgtggaagaatacgcgcgacaaaaactg
gcgcgtaagaaactggatttaatttgcgctaatgatgtatcgcttgcagagcatgggttt
aacagtgacaccaatgccttgcaccttttttggcagaatggagaaaagcgcctggcgctg
agcgataaggcactccttggccaacgtttaatagacgagatagtcagccgttatgatgaa
aaaaatcgacgttaa

DBGET integrated database retrieval system