KEGG   Serratia plymuthica 4Rx13: SOD_c46600Help
Entry
SOD_c46600        CDS       T02710                                 

Gene name
yicC
Definition
(GenBank) UpF0701 protein YicC
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YicC_N DUF1732 Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: AGO57596
UniProt: S0ALC2
Position
5233427..5234290
Genome map
AA seq 287 aa AA seqDB search
MIRSMTAYARSEIKGEWGSAAWELRSVNQRYLETYIRLPEQFRSLEPVIRERIRGRLTRG
KVECNLRFELDPSAQSSLILNEKLAKQLVEAANWVKMQSDEGEIDPIDVLRWPGVMSAQE
QDLDAISAQLMQALDSALDDFITARESEGTALKALIEQRLDGVSAEVIKVRAQMPNILQW
QRERLVSKLEEAQVQLENTRLEQELVLMAQRIDVAEELDRLEAHVKETHNILKKKEAVGR
RLDFMMQEFNRESNTLASKSINADVTTSAIELKVLIEQMREQIQNIE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcagcatgaccgcctacgcacggagtgaaatcaagggtgaatggggcagcgca
gcttgggagctgcgttccgttaaccaacgctatctagaaacctacatccgtttaccggag
caattccgcagcctggagccggtgatccgcgaacgtatccgtggccgtctgacccgtggc
aaagtggaatgcaacctgcgcttcgagctggacccgagcgcgcaaagctcgctgatcctg
aacgaaaaactggctaaacagctggttgaagccgccaactgggtaaaaatgcagagcgac
gaaggggaaatcgatcctatcgacgtcttgcgttggccgggtgtgatgtctgctcaggag
caggatctggacgccatcagcgcacagctgatgcaggctctggatagcgcattggatgat
ttcatcaccgctcgcgaaagcgaaggcaccgcgctgaaagccctgatcgaacagcgcctc
gacggcgtcagcgccgaagtgatcaaagtgcgcgcccagatgccaaacatcctgcaatgg
cagcgtgagcgcctggtcagcaagctggaagaagctcaggtgcagttggaaaacactcgc
ctggaacaggagctggtgttgatggcgcaacgtattgacgttgccgaagagctggaccgt
ctggaagcccacgtaaaagaaacgcataacatcctgaagaagaaagaagccgtgggccgc
cgcctcgactttatgatgcaggagtttaaccgcgaatcgaacacgctggcgtccaagtcg
attaatgccgacgtcaccacttccgctatcgaactgaaagtgctgatcgagcaaatgcgc
gagcagatccagaacatcgagtga

DBGET integrated database retrieval system