KEGG   Serratia plymuthica 4Rx13: SOD_c46610Help
Entry
SOD_c46610        CDS       T02710                                 

Gene name
nupC
Definition
(GenBank) nucleoside permease NupC
  KO
K03317  concentrative nucleoside transporter, CNT family
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SOD_c46610 (nupC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N Gate
Motif
Other DBs
NCBI-ProteinID: AGO57597
UniProt: S0AM53
Position
5235000..5236184
Genome map
AA seq 394 aa AA seqDB search
MPQILQFIFALVVIIALALLVSNDRKKIRLRYIIQLLVIEGALAYFFLHSESGLSVIRHV
AGFFETLLTYAAQGSDFVFGGMSKDGLAFIFLGVLCPIIFISALIGILQHFRILPLIIRL
VGTLLSKVNGMGKLESFNAVSTLVLGQSENFIAYKGIIGDISPRRMYTMAATAMSTVSMS
IVGAYMSMIDAQYVVAALILNMFSTFIILSIINPYQLDDEPELKLNKLHEDQSFFEMLGE
YILAGFKIAMIIAAMLIGFIALISAVNALFSAVFGISFQQILGYVFYPLAWLIGIPAQDA
LRAGSIMATKLVANEFVAMIELKKIATELSPRGLGILSVFLVSFANFASIGIVAGAIKGL
NERQGNVVSRFGLKLVYGSTLVSLLSAAIAGLVL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaattctgcaatttattttcgccctggtggtgatcatcgccctggcgttgctg
gtcagcaacgatcgcaagaaaatccgcctgcgctatattattcagctgttggtcattgaa
ggtgcactcgcctatttcttcctgcattcagaaagtggcctcagcgtaatcagacacgtc
gccggcttctttgaaacgctgctgacctacgcagcgcaaggctccgactttgttttcggt
ggcatgagcaaggacgggctggcgttcattttcctgggcgttttgtgcccgattatcttt
atttccgcgctaatcggtattttgcagcactttcgtattttgccgctgattatccgcctg
gtcggcaccctgctgtccaaggttaacggcatgggcaagctggagtctttcaacgccgtc
agcacgctggtactcggtcagtcggaaaacttcatcgcctataaggggatcatcggcgat
atttcgccgcgccgcatgtacaccatggccgcaaccgccatgtcgacggtctccatgtcc
atcgttggcgcctacatgtcgatgatcgatgcgcaatacgtggttgcggcactgatcctc
aatatgttcagcacctttatcattctgtcgatcatcaacccttatcaactggacgatgag
cctgaactgaaactgaacaaactgcatgaagatcagagcttctttgaaatgctgggcgaa
tacattctggcgggcttcaagattgcgatgattatcgccgcgatgctgattggttttatt
gcgctgatctctgcggtaaatgctctgttctcggccgtgttcggcatcagcttccagcaa
attctgggctacgtgttttatccgctggcctggttgatcggcatcccggcacaggatgcg
ttgcgggccggcagcatcatggcgaccaagttggtggccaatgaattcgtggcgatgatc
gagttgaagaaaattgcgacggaactgtcgccgcgcggcctgggtattttgtccgtgttc
ctcgtctcctttgccaactttgcctctatcggcatcgtcgccggggcgatcaaagggctg
aatgaacgacaaggcaacgtggtatcccgctttggtctgaagctggtctatggttcaacg
ctggtcagcctgctctcggcagccatcgcagggttggtgctgtaa

DBGET integrated database retrieval system