KEGG   Serratia plymuthica 4Rx13: SOD_c46710Help
Entry
SOD_c46710        CDS       T02710                                 

Gene name
recG
Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:srl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SOD_c46710 (recG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:srl03400]
    SOD_c46710 (recG)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SOD_c46710 (recG)
DNA repair and recombination proteins [BR:srl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SOD_c46710 (recG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecG_wedge DEAD Helicase_C ResIII tRNA_anti-codon SecA_DEAD AAA_30 SNF2_N Helicase_RecD ERCC3_RAD25_C DUF2075 DUF2791 RC-P840_PscD DNA_pol_lambd_f ATPase Cdd1
Motif
Other DBs
NCBI-ProteinID: AGO57607
UniProt: S0AM62
Position
5245885..5247999
Genome map
AA seq 704 aa AA seqDB search
MVGNHAGNGTPMKGRLLDAVPLTTLSGVGASQAGKLAKIGLETIQDLLLHLPLRYEDRTR
LYPINDLLPGIFATVEGEVLRSDISFGRRRMLTCQISDGTGLLTMRFFNFNAAMKNSLAA
GRRVTAYGEIKRGNHGAEIIHPEYRIQGESSEVELQESLTPVYPTTEGIRQATLRKLTDQ
ALELLDTCAIAELLPPELSGGLMSLPQALHTLHRPPPDIQLEDLEQGKHPAQKRLILEEL
LAHNLSMLAVRAGAQSYQALPLMPDDRLKQQFLAELPFSPTGAQERVVADIEADMQKGFP
MMRLVQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRQWFEPLGLEVG
WLAGKQKGKARIAQQEAIASGKVSMVVGTHAIFQEQVQFSGLALVIIDEQHRFGVHQRLA
LWEKGEEQGFHAHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPVTTVAIPDTRRA
DIIQRVKSACMEEGRQAYWVCTLIEESELLEAQAAEATWEELKTALPELKVALVHGRMKA
QEKQAVMQAFKQGELQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGA
VASHCVLLYKTPLSKTAQKRLQVLRDSNDGFVIAQRDLEIRGPGELLGTRQTGSAEFKVA
DLLRDQAMIPEVQRVARHIHQQYPEHARALIERWLPEKARYSNA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcaaccatgcaggcaacggtacgccgatgaaaggccgcctgctggacgccgtc
cctctcaccacgctttccggggttggagccagccaggcgggcaagctggccaaaattggc
ctggaaaccattcaggacctgctgctgcacctcccgctgcgttatgaagaccgcactcgt
ctctatccgatcaacgatctgctgccgggcatttttgccacggtggaaggcgaagtgctg
cgcagcgatatcagttttggccgtcggcgtatgctgacctgccaaatcagcgacggtacc
ggcttgctcaccatgcgtttctttaacttcaacgcagcgatgaaaaacagcctggccgca
ggccggcgcgtgaccgcttacggtgagatcaaacgcggtaaccacggcgcagaaatcatc
cacccggaataccgcattcagggggaaagcagcgaggttgagctgcaagaatcactgacg
ccggtttatccgaccaccgaaggcatcaggcaagccacgctgcgcaagctgaccgatcag
gcgctggagctgctggacacctgcgccatcgccgaactgctgccaccggaactcagtggc
gggctgatgagcctgccgcaggcgctgcacaccctgcaccgcccgccgccggatatccag
ctggaagatttggaacagggcaagcatccggcgcaaaaacgcctgatcctggaagagctg
ctggcgcataacctcagcatgttggcggtacgcgccggcgcgcagagttatcaggcgctg
ccgctgatgccggatgaccgtctgaaacaacaatttctcgccgaattgccgttttcgccg
accggcgcgcaagagcgcgtggtggccgatatcgaagccgatatgcaaaaaggcttcccg
atgatgcgattggtacaaggtgatgtcggctcaggcaaaacgctggtagcagcgctggcg
gcgctgcgcgccatcgcccacggcaaacaggtggcattgatggcgcccaccgagctgctg
gccgaacaacacgccaataacttccgccagtggtttgaaccgttggggcttgaagtcggc
tggctggccggcaagcaaaaaggcaaggcacgcattgctcagcaggaagcgatcgccagc
ggaaaagtgtcgatggtggtcggtacgcacgccatcttccaggaacaggtacagttttcc
ggcctggcgctggtgatcatcgacgaacagcaccggtttggcgtgcaccaacggctggct
ctgtgggaaaagggcgaggagcaaggcttccatgcccaccagttgatcatgaccgccacg
ccaatcccacgcacgctggcaatgaccgcctatgccgatctcgatacctcggtgatcgac
gaactgccgccaggcaggacaccggtcaccaccgtcgccattcctgacacccggcgcgcc
gatattatccagcgggtaaaaagcgcctgtatggaagaaggccggcaggcgtactgggtc
tgtacgttgatcgaggagtcggagttgctggaagcgcaggcggcagaagccacctgggaa
gagttgaagacagcgctgcccgaactgaaagtcgctctggttcacggccgcatgaaagca
caggaaaagcaggcggtaatgcaggcctttaaacagggcgagttacagctgttggtggca
accaccgtgatcgaagtgggcgtcgacgtaccgaacgccagcctgatgatcatcgaaaac
ccggagcggcttggattggcgcaactgcatcagttgcgcggccgcgttggccgtggcgct
gtggcatcgcattgcgtgctgttgtacaaaaccccgctgagtaaaactgcgcagaaacgt
ctgcaggttctgcgcgacagtaacgatggcttcgtgattgcccagcgcgatctggaaatt
cgtggcccaggcgagctgcttgggacgcgccagaccggcagtgcggagttcaaggtggcc
gacttgctgcgcgaccaggcgatgataccggaagtgcaacgcgtcgcccgtcatattcac
cagcaatatccggaacatgcccgcgccctgattgaacgctggctaccggagaaagcgcgc
tactccaacgcctga

DBGET integrated database retrieval system