KEGG   Serratia plymuthica 4Rx13: SOD_c46780Help
Entry
SOD_c46780        CDS       T02710                                 

Gene name
yihX
Definition
(GenBank) alpha-D-glucose-1-phosphate phosphatase YihX
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00010  Glycolysis / Gluconeogenesis
srl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOD_c46780 (yihX)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SOD_c46780 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase SHOCT HAD Acid_PPase Hydrolase_like NT5C PNK3P
Motif
Other DBs
NCBI-ProteinID: AGO57614
UniProt: S0ANS7
Position
complement(5255087..5255677)
Genome map
AA seq 196 aa AA seqDB search
MLYIFDLGNVIVDIDFKRVLGVWSNLSGTPLAVLSERFTLGELFQQHERGEISDEDFAER
LSDEMGIALSFEQFATGWQAVFVALRPEVIDIMKRLRSEGHRVVVLSNTNRLHCNYWPQH
YPEVAEAADHLYLSQDIGMRKPDANIYLHVLNAENTPPEAAVFFDDHPDNVAAAQALGIK
TVHVTDRNVVPAYFAQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatatctttgatttaggtaatgtgattgtcgatatcgatttcaaacgtgtactg
ggtgtatggagcaatttgagtggcacgccgctggcggtattgtctgagcgtttcaccctg
ggtgagttgttccagcagcatgagcgaggtgaaatcagcgacgaagattttgccgaacgg
ctaagtgatgaaatgggtatcgccctcagttttgagcagttcgctaccggctggcaggcg
gtgtttgtcgccctgcgtccggaggtgatcgatatcatgaagcgcctgcgcagcgaaggt
caccgggtggtggtgttgtcgaacaccaatcgtctgcactgcaactattggccgcagcat
tatccggaagtggccgaggccgccgatcatctgtatctgtctcaggacatcggtatgcgc
aaaccggacgccaacatctatctgcacgtactcaacgccgaaaatacgccgccggaagcc
gcagtgttcttcgacgatcatccggataacgtcgccgccgcacaggcgctgggaatcaaa
acggtgcacgtgaccgaccgtaacgtggtgcctgcttattttgcccaatga

DBGET integrated database retrieval system