KEGG   Serratia plymuthica 4Rx13: SOD_c46880Help
Entry
SOD_c46880        CDS       T02710                                 

Gene name
dsbA
Definition
(GenBank) thiol:disulfide interchange protein DsbA
  KO
K03673  thiol:disulfide interchange protein DsbA
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl01503  Cationic antimicrobial peptide (CAMP) resistance
Module
srl_M00728  Cationic antimicrobial peptide (CAMP) resistance, envelope protein folding and degrading factors DegP and DsbA
Brite
KEGG Orthology (KO) [BR:srl00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SOD_c46880 (dsbA)
Chaperones and folding catalysts [BR:srl03110]
 Protein folding catalysts
  Protein disulfide isomerase
   SOD_c46880 (dsbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin Thioredoxin_2 Glutaredoxin DUF3088 Thioredoxin_5
Motif
Other DBs
NCBI-ProteinID: AGO57624
UniProt: S0ANT6
Position
complement(5270639..5271262)
Genome map
AA seq 207 aa AA seqDB search
MKKIWLALVGMVMAFSASAAQFSDGSQYVTLDKPVTGEPQVLEFFSFYCPHCYQFEQVYH
VSENVKKALPAGTKMTKYHVEFLGPLGKQLTQAWAVAMALGVEDKVSPLMFEAVQKTQTV
QTPDDIRNVFVKAGVSAEDYDAAWNSFVVKSLVVQQEKAAEDLQLRGVPAVFVNGKFMVK
NDGLDTSSMDAYVKQFADVVKFLSQQK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatatggttggcgctcgttggcatggtaatggcattcagtgcctcggctgcg
cagtttagcgatggttctcagtatgtaaccctggacaaaccggtgaccggtgaacctcag
gtgctggagttcttttccttctattgcccgcactgctatcagttcgagcaggtttaccac
gtttccgagaacgtgaaaaaagcgctgcctgcaggcaccaaaatgaccaaataccacgtt
gagtttctggggccgctgggtaaacagctgactcaggcctgggcggttgcgatggcgctg
ggtgtggaagataaagtgagcccgctgatgtttgaagccgtacaaaaaactcagaccgtg
caaacccctgatgatatccgtaacgtgtttgtcaaagccggcgtgagtgcggaagactac
gatgcggcctggaacagctttgtggtgaaatccctggtggttcaacaggagaaagctgcg
gaagatctgcagctgcgcggtgttccggcagtatttgtgaacggtaagtttatggttaaa
aatgatggcctggacaccagctcgatggatgcttacgtgaagcaattcgccgacgtggtt
aaattcctcagccagcagaaataa

DBGET integrated database retrieval system