KEGG   Serratia plymuthica 4Rx13: SOD_c46890Help
Entry
SOD_c46890        CDS       T02710                                 

Gene name
rdoA
Definition
(GenBank) protein RdoA
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH EcKinase
Motif
Other DBs
NCBI-ProteinID: AGO57625
UniProt: S0AP72
Position
complement(5271292..5272296)
Genome map
AA seq 334 aa AA seqDB search
MKLNVVMNNSAFNFQTLSPDLIMDALEGVGLRVDSGLTALNSYENRVYQFMDEDRKRYVV
KFYRPERWNAAQIIEEHQFAGDLAQAEIPAVAPLALQGNTLHTHSGFFFTVFPSVGGRQY
EIDNLDQLEWVGRFLGRIHQVGSESLFAERPTMGIEEYLTAPREVLAGCKLLPKAQRDSF
LTATDALIEAIKHHWHLDWQPRRLHGDCHPGNILWRDGPLFVDLDDARNGPAVQDLWMLL
HGERRDRLMQLDVLLEAYSEFAEFDQSELALIEPLRAMRMVYYLAWVARRWQDPAFPKSF
PWMAESDFWLSQTAAFTEQVKLLQEPPLQLMPMY
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaatgttgttatgaacaactccgcttttaattttcaaaccctgtcgcccgac
ctgattatggacgcgctggaaggggttggcctgcgtgtagattccgggctaacggcgctg
aacagctatgaaaaccgcgtttatcagtttatggacgaagatcgtaagcgctacgtggtg
aagttttaccggcccgaacgttggaatgcggcgcaaattattgaagaacaccagttcgcc
ggggatcttgctcaggcggagatccctgcagttgcgccgctggctctacagggcaatacg
ctacatacgcacagcggtttcttttttaccgtatttcccagcgttggcgggcgtcagtat
gagatagacaacctcgatcaactggagtgggttggccgtttcctggggcgtattcatcag
gtgggcagtgaaagcctgtttgcggagcgtcctacaatggggattgaagaatatctcacc
gcgccgcgtgaagtgctggctggctgcaaactgttgcccaaggcacagcgcgacagcttc
ctgactgcgacggacgctctgattgaggcgataaaacaccattggcatctggactggcag
ccgcggcgtttgcacggtgactgtcacccgggcaatatcctgtggcgtgatggcccactg
tttgttgatcttgacgatgcgcgcaatgggccggcggtacaggatctgtggatgctgttg
cacggtgagcgccgtgatcgcctgatgcagctggatgttttgctggaggcttactcagag
tttgccgagtttgatcagagtgagttggcgttgatcgaacctttgcgtgccatgcgaatg
gtgtactacctggcatgggtagctcgccgttggcaggatcccgcatttcctaaaagtttt
ccgtggatggcggagtctgatttctggttatctcagaccgcggcattcactgaacaggtt
aagctgttgcaggaacctcctctgcagctgatgccaatgtattga

DBGET integrated database retrieval system