KEGG   Serratia plymuthica 4Rx13: SOD_c46990Help
Entry
SOD_c46990        CDS       T02710                                 

Gene name
rbsR
Definition
(GenBank) ribose operon repressor
  KO
K02529  LacI family transcriptional regulator
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srl03000]
    SOD_c46990 (rbsR)
Transcription factors [BR:srl03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    SOD_c46990 (rbsR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_Tnp_ISL3 HTH_38 HTH_3 HTH_31 MerR HTH_23 HTH_17 Rad10
Motif
Other DBs
NCBI-ProteinID: AGO57631
UniProt: S0ALF4
Position
complement(5281962..5282963)
Genome map
AA seq 333 aa AA seqDB search
MATMKDVARLAGVSTSTVSHVINNNRFVSDSVRDKVMAAVEQLNYAPSALARSLKLNQTR
TIGMLVTSSNNPFYAEVVRGVERSCYERGYSLILCNTEEDAARMNRSMETLLQKRVDGLL
LMCTENHRPSQDALSRYPSLPIVMMDWAPFEGANDIIQDNSLLGGEMATDHLIARGYRNI
ACIAGPQDKTTARHRLEGYRRAMQRAGLAILPGYEVHCDFEFEGGVAAMKQLLALAEPPH
AVFAGNDAVAVGAYQALYQAGLSVPQDMAVMGYDDIELAKYLAPPLSTIHQPKDSLGELA
IDALINRLQNPEREAQVLVLTPELVERASVGHR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttggccaccatgaaagatgtcgctcgcctggcgggcgtttcaacctcgacggtttcacac
gttatcaataacaatcgctttgtcagcgacagcgtgcgcgacaaggtcatggcggccgtt
gaacaattgaactatgcgccctccgcgctggcgcgcagcctgaagctgaaccagacgcgg
accattggcatgctggttacctccagcaacaacccgttctatgccgaagtggtgcgtggc
gttgagcgcagttgctacgagcgcggctacagcctgatcctgtgcaataccgaagaagat
gccgcacgcatgaaccgcagcatggagacgctgttgcaaaaacgcgtcgatggcctgttg
ttgatgtgcaccgaaaaccaccgaccgtcccaggacgcgctgagccgctatccgtcgctg
ccgattgtgatgatggactgggcacccttcgaaggggctaacgatatcattcaggataac
tcgttgctgggcggggagatggcgaccgatcaccttatcgcccgtggttatcgcaacatt
gcctgtatcgccggcccgcaggataaaaccactgcacgccatcgtttggaaggctaccgc
cgcgccatgcaacgcgccgggctggcgatcctgcccggatacgaagtgcattgcgacttc
gagtttgaaggcggcgttgccgcgatgaaacagttgctggcgctggccgaaccgccgcat
gcggtattcgccggtaacgatgcggtagcggtaggtgcctatcaggcgttgtaccaggcc
gggctgtcggtaccgcaggacatggcggtgatgggctacgatgatatcgagctggccaaa
tacctcgcgccgccgctaagtaccattcaccagccgaaagattcgctgggggaactggcg
attgatgcgttgatcaaccgcctgcagaacccggaacgggaagcccaggtcctggtgctg
accccggagctggtggagcgcgcttcggtgggtcaccgctag

DBGET integrated database retrieval system